|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G23630 | AT | Annotation by Michelle Graham. TAIR10: VIRB2-interacting protein 1 | chr4:12318070-12319574 FORWARD LENGTH=275 | SoyBase | E_val: 7.00E-15 | ISS |
| GO:0071786 | GO-bp | Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum tubular network organization | SoyBase | N/A | ISS |
| GO:0005773 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuole | SoyBase | N/A | ISS |
| GO:0005783 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum | SoyBase | N/A | ISS |
| GO:0005789 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum membrane | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0071458 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: integral to cytosolic side of endoplasmic reticulum membrane | SoyBase | N/A | ISS |
| GO:0071782 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum tubular network | SoyBase | N/A | ISS |
| UniRef100_C6TGE9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=2 Tax=Glycine max RepID=C6TGE9_SOYBN | SoyBase | E_val: 7.00E-19 | ISS |
| UniRef100_D7M928 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: VIRB2-interacting protein 1 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7M928_ARALL | SoyBase | E_val: 1.00E-12 | ISS |
|
Glyma18g16360 not represented in the dataset |
Glyma18g16360 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g16360.1 sequence type=CDS gene model=Glyma18g16360 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high AACAAGAAAATTTCTGCTGGTGCACTTGGCAGAGCCACTGCTGTTTGGTTCTGTTCTTGTGGTCCAATGCCCATACTTTCATCCACAAGTAAGCCTCTAAAACTTTGTAAATTTCATCTTCCAGAGGAGCCATTCCTGCAAGTTGTGTCTGCATTGAGAATTGAAATCAACGGGGGATTTGCCGTTTTGCATAGTATTGGCTCTGGAAGGGACTTGACGAAATTCCTA
>Glyma18g16360.1 sequence type=predicted peptide gene model=Glyma18g16360 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high NKKISAGALGRATAVWFCSCGPMPILSSTSKPLKLCKFHLPEEPFLQVVSALRIEINGGFAVLHSIGSGRDLTKFL
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||