Glyma18g16212 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g16212): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g16212): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g16212

Feature Type:	gene_model
Chromosome:	Gm18
Start:	16624280
stop:	16625755
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g16212

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G75220	AT	Annotation by Michelle Graham. TAIR10: Major facilitator superfamily protein \| chr1:28229412-28232606 REVERSE LENGTH=487	SoyBase	E_val: 1.00E-54	ISS
GO:0009694	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid metabolic process	SoyBase	N/A	ISS
GO:0009753	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus	SoyBase	N/A	ISS
GO:0010030	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of seed germination	SoyBase	N/A	ISS
GO:0042593	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucose homeostasis	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009705	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plant-type vacuole membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0005351	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sugar:hydrogen symporter activity	SoyBase	N/A	ISS
GO:0015144	GO-mf	Annotation by Michelle Graham. GO Molecular Function: carbohydrate transmembrane transporter activity	SoyBase	N/A	ISS
GO:0022857	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transmembrane transporter activity	SoyBase	N/A	ISS
PTHR24063	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24063:SF74	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00083	PFAM	Sugar (and other) transporter	JGI		ISS
UniRef100_Q9FRL3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Sugar transporter ERD6-like 6 n=1 Tax=Arabidopsis thaliana RepID=ERDL6_ARATH	SoyBase	E_val: 7.00E-52	ISS
UniRef100_UPI000233E15C	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E15C related cluster n=1 Tax=unknown RepID=UPI000233E15C	SoyBase	E_val: 6.00E-60	ISS

Expression Patterns of Glyma18g16212

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g16212 not represented in the dataset	Glyma18g16212 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g16212 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g124900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g16212

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g16212

Limit To All Plant Sequences

>Glyma18g16212.1   sequence type=CDS   gene model=Glyma18g16212   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGGGAGCTATAGCGAGTGGTCAGATAGCTGAATGTATCGGGCGCGAAGGGTCATTGATGATTGCTGCGATCCCCAATATAATAGGGTGGCTTGCTATTTCTTTTGCCAAAGATTCCTCATTTTTGTATATGGGGAGGTTGTTGGAAGGTTTTGGCGTTGGGATTATCTCTTATGTGGTGCTTGTTTATATAGCTGAGATTGCACCTCAAAACTTGAGAGGTGGCCTTGGATCAGTGAACCAGCTCTCTATTACAATTGGCATTATGTTGGCTTATCTGTTGGGTCTTTTTGTCAACTAG

Predicted protein sequences of Glyma18g16212

Limit To All Plant Sequences

>Glyma18g16212.1   sequence type=predicted peptide   gene model=Glyma18g16212   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVGAIASGQIAECIGREGSLMIAAIPNIIGWLAISFAKDSSFLYMGRLLEGFGVGIISYVVLVYIAEIAPQNLRGGLGSVNQLSITIGIMLAYLLGLFVN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain