SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g15935): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g15935): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g15935

Feature Type:gene_model
Chromosome:Gm18
Start:16117338
stop:16119316
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g15935
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G18520AT Annotation by Michelle Graham. TAIR10: tetraspanin11 | chr1:6375051-6376178 FORWARD LENGTH=271 SoyBaseE_val: 2.00E-23ISS
GO:0007568GO-bp Annotation by Michelle Graham. GO Biological Process: aging SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR19282Panther TETRASPANIN JGI ISS
PTHR19282:SF137Panther JGI ISS
PF00335PFAM Tetraspanin family JGI ISS
UniRef100_G7JT30UniRef Annotation by Michelle Graham. Most informative UniRef hit: Senescence-associated protein n=1 Tax=Medicago truncatula RepID=G7JT30_MEDTR SoyBaseE_val: 1.00E-42ISS
UniRef100_UPI0001D62D6AUniRef Annotation by Michelle Graham. Best UniRef hit: UPI0001D62D6A related cluster n=1 Tax=unknown RepID=UPI0001D62D6A SoyBaseE_val: 1.00E-60ISS

Expression Patterns of Glyma18g15935
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g15935 not represented in the dataset
Glyma18g15935 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g15935 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g123300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g15935
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g15935
>Glyma18g15935.1   sequence type=CDS   gene model=Glyma18g15935   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAAGTGGTTGGGTTGGTAATCTTAAGGCAGTAGTGATATTGGTGATTGTGATGGTGTGGAGGTTGAAGTGGAGAAGTTGTGTGCTTGATAAATTTGATATGGTAAAGGTGTTGAATATGATGAGTGTCGATGTTTTGGCACCCAACAATCACCTAAAGCAGGCCACTACGTCGTCGCGAGCATTGTTTCGCATAAGCAAAATTGTGGTTGGAGCCCTCAACGTGTTGTCCCTTCTGTTGGGCATCGGCTCCGCGGGGGAGCCCGCGTACATCCACGTCCATGGTGACTCCAATTGCCAGAAGGTGCTGCTGCAGGTTCCACTCCTCGTGGGTGGAATCTTCGTGGTGCTGGTCTCGGCCCTAGGAATCGCGGGGTCACTGTGCTGCGTGAACGGGGCGCTCTATGTGTACCTGTTGGTGATGTTCATGGTGATCGTGGGGCTGGCATTCTTCACCGTGTTCGAGCTCTTCGTCACCAACAGGAAGATGGGCCAGCAGGTTTCCAACAAGGGCTACGGCGAGTACAAGGTCACCAACTTCTCTCATTGGCTACAGCATATGGTTAACAACAAGAACTGA
Predicted protein sequences of Glyma18g15935
>Glyma18g15935.1   sequence type=predicted peptide   gene model=Glyma18g15935   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTSGWVGNLKAVVILVIVMVWRLKWRSCVLDKFDMVKVLNMMSVDVLAPNNHLKQATTSSRALFRISKIVVGALNVLSLLLGIGSAGEPAYIHVHGDSNCQKVLLQVPLLVGGIFVVLVSALGIAGSLCCVNGALYVYLLVMFMVIVGLAFFTVFELFVTNRKMGQQVSNKGYGEYKVTNFSHWLQHMVNNKN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo