Glyma18g15620 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g15620

Feature Type:	gene_model
Chromosome:	Gm18
Start:	15824164
stop:	15824881
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g15620

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G48560	AT	Annotation by Michelle Graham. TAIR10: basic helix-loop-helix (bHLH) DNA-binding superfamily protein \| chr5:19684160-19686871 FORWARD LENGTH=498	SoyBase	E_val: 4.00E-20	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0016132	GO-bp	Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
UniRef100_B9T7X6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor, putative n=1 Tax=Ricinus communis RepID=B9T7X6_RICCO	SoyBase	E_val: 5.00E-21	ISS
UniRef100_I1KZ15	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KZ15_SOYBN	SoyBase	E_val: 2.00E-32	ISS

Expression Patterns of Glyma18g15620

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g15620 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g15620

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g15620

Limit To All Plant Sequences

>Glyma18g15620.1   sequence type=CDS   gene model=Glyma18g15620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGAATTCTCAGCTGATCCTGGCTTTGCTGAGAAGGCTACAAAGCTTTGTTGCTTTGGAAGTAGGAGTTTCAATGGCATGACCACCCAATTAAGAAGCAGCTCCCTACAGTCTCAAGTAGTCCATCACTCAAAGTGTTGGGATCTCAAATGGGAAAAGAAAAGGAAAAGCCAAATAAACTTGAACCTCTACCAACCCCCCTATGCTAAGCACTTTTTAATGGTCTTTCACTTCAAGCTGCTGAAGCTAGCGAAGACCAATGCAAAGCGCAACAAGCCTAACAAAGGTGAGGGGAATGAAAATGGCCAAGTGAAGGCAGAGGAAGAGTCCAAAGGACGTAATAATCATAATGCAAATGATGAGAAACAGAGCAAGAGTAACTCAAAACCTCCTGAGCCTCCAAAGGATTACATTCATGTTAGAGCAACACGAGGTCAAGCCACTAATAATCATAGTCTTGCAGAAAGA

Predicted protein sequences of Glyma18g15620

Limit To All Plant Sequences

>Glyma18g15620.1   sequence type=predicted peptide   gene model=Glyma18g15620   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEFSADPGFAEKATKLCCFGSRSFNGMTTQLRSSSLQSQVVHHSKCWDLKWEKKRKSQINLNLYQPPYAKHFLMVFHFKLLKLAKTNAKRNKPNKGEGNENGQVKAEEESKGRNNHNANDEKQSKSNSKPPEPPKDYIHVRATRGQATNNHSLAER

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain