Glyma18g15580 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g15580): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g15580): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g15580

Feature Type:	gene_model
Chromosome:	Gm18
Start:	15768215
stop:	15770548
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g15580

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G17420	AT	Annotation by Michelle Graham. TAIR10: Cellulose synthase family protein \| chr5:5736859-5741407 REVERSE LENGTH=1026	SoyBase	E_val: 7.00E-108	ISS
GO:0009832	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis	SoyBase	N/A	ISS
GO:0009834	GO-bp	Annotation by Michelle Graham. GO Biological Process: secondary cell wall biogenesis	SoyBase	N/A	ISS
GO:0010089	GO-bp	Annotation by Michelle Graham. GO Biological Process: xylem development	SoyBase	N/A	ISS
GO:0010228	GO-bp	Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem	SoyBase	N/A	ISS
GO:0010400	GO-bp	Annotation by Michelle Graham. GO Biological Process: rhamnogalacturonan I side chain metabolic process	SoyBase	N/A	ISS
GO:0010413	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process	SoyBase	N/A	ISS
GO:0016926	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein desumoylation	SoyBase	N/A	ISS
GO:0030244	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process	SoyBase	N/A	ISS
GO:0042546	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall biogenesis	SoyBase	N/A	ISS
GO:0044036	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule metabolic process	SoyBase	N/A	ISS
GO:0045492	GO-bp	Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process	SoyBase	N/A	ISS
GO:0050665	GO-bp	Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide biosynthetic process	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0016759	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cellulose synthase activity	SoyBase	N/A	ISS
GO:0016760	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cellulose synthase (UDP-forming) activity	SoyBase	N/A	ISS
PTHR13301	Panther	X-BOX TRANSCRIPTION FACTOR-RELATED	JGI		ISS
PTHR13301:SF24	Panther		JGI		ISS
PF03552	PFAM	Cellulose synthase	JGI		ISS
UniRef100_I0IJY6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cellulose synthase 3 (Fragment) n=2 Tax=Eucalyptus RepID=I0IJY6_9MYRT	SoyBase	E_val: 2.00E-124	ISS
UniRef100_UPI000233EDA6	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233EDA6 related cluster n=1 Tax=unknown RepID=UPI000233EDA6	SoyBase	E_val: 2.00E-146	ISS

Expression Patterns of Glyma18g15580

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g15580 not represented in the dataset	Glyma18g15580 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g15580 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g15580

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g15580

Limit To All Plant Sequences

>Glyma18g15580.1   sequence type=CDS   gene model=Glyma18g15580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GATGATGAGAATGCTCAATTCTCAGTTGTTATTGCTGGTGGTCACTTTTGGCCTGTTAGTGGGGAGTTCCCAATAGCATCTCATTATGGGGATCAGATGTTAGCTTCTTCACTGCAAAATCGAGTGCACCCATATCCCGCGTTTGATCCTCGAAATGGAAAATGGGATGAAGCCAAAGAGGATAGAATGGATGACTGGAAGTTGCAACAAGGCAATTTGGGGCCTGAACCTGATGAAGATCCAGATGCAGCCATGTTAGATGAAGCAAGGCAACCATTGTCAAGGAAGGTACCAATAGCATCCAGCAAAGTGAATCCATATAGGATGGTGATCGTGGCACGACTTGTTATCCTTGCCTTCTTCCTTCGATATAGACTTATGAATCCTATACATGATGCAATGGGACTGTGGCTAACTTCTATTATATGTGAAATCTGGTTTGCTTTTTCAAGGATCCTTGATCAGCTTCCCAAATGGTATCCCATTGATCGAGAAACATACCTTGATCATCTTTCAATTAGGTATGAACGTGAAGGTGAACCTAACATGCTTGCTCCAGTGGATGTCTTTGTTAGTACTGTGGATCCCATGAAAGAACCTCCTTTGGTTATAGCCAACATTGTTCTTTCAATCTTGGCCATGGATTACCCAGTTGGTAAGATATTGTGTTACATTTTTGATGATGGAGCTTCAATGTGTACACTTTCCTTATGTTGGAATAAACCTCTCAATTGGAAGGGATCACCAGATCCCTGTAATGATGGTTGGGATGGAATCAAGTGCATCAACTCACGCGAGCTTTCAGAAGATATCGGGTTACTGTCTGAATTGGAGACGCTATACGTTTTTAATTTATTGCACTCAGCATGCTTTTGCGATAAATTATTTATGATCTTATCCCTTTTGATTTCCTTGTTTCTGATTTGTAGAGACCTCTCTCACAGTAAGGGCTTAACTGGTTCACTTCCACATTCAATTGGAAATTTGACCAAGTTGTCAAACTTTCAAAATTGTTCCAAATGCAATTGCTCAATTATCTCATTTTCCGCTTAA

Predicted protein sequences of Glyma18g15580

Limit To All Plant Sequences

>Glyma18g15580.1   sequence type=predicted peptide   gene model=Glyma18g15580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
DDENAQFSVVIAGGHFWPVSGEFPIASHYGDQMLASSLQNRVHPYPAFDPRNGKWDEAKEDRMDDWKLQQGNLGPEPDEDPDAAMLDEARQPLSRKVPIASSKVNPYRMVIVARLVILAFFLRYRLMNPIHDAMGLWLTSIICEIWFAFSRILDQLPKWYPIDRETYLDHLSIRYEREGEPNMLAPVDVFVSTVDPMKEPPLVIANIVLSILAMDYPVGKILCYIFDDGASMCTLSLCWNKPLNWKGSPDPCNDGWDGIKCINSRELSEDIGLLSELETLYVFNLLHSACFCDKLFMILSLLISLFLICRDLSHSKGLTGSLPHSIGNLTKLSNFQNCSKCNCSIISFSA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain