SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g15580

Feature Type:gene_model
Chromosome:Gm18
Start:15768215
stop:15770548
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g15580
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G17420AT Annotation by Michelle Graham. TAIR10: Cellulose synthase family protein | chr5:5736859-5741407 REVERSE LENGTH=1026 SoyBaseE_val: 7.00E-108ISS
GO:0009832GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis SoyBaseN/AISS
GO:0009834GO-bp Annotation by Michelle Graham. GO Biological Process: secondary cell wall biogenesis SoyBaseN/AISS
GO:0010089GO-bp Annotation by Michelle Graham. GO Biological Process: xylem development SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010400GO-bp Annotation by Michelle Graham. GO Biological Process: rhamnogalacturonan I side chain metabolic process SoyBaseN/AISS
GO:0010413GO-bp Annotation by Michelle Graham. GO Biological Process: glucuronoxylan metabolic process SoyBaseN/AISS
GO:0016926GO-bp Annotation by Michelle Graham. GO Biological Process: protein desumoylation SoyBaseN/AISS
GO:0030244GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process SoyBaseN/AISS
GO:0042546GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall biogenesis SoyBaseN/AISS
GO:0044036GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule metabolic process SoyBaseN/AISS
GO:0045492GO-bp Annotation by Michelle Graham. GO Biological Process: xylan biosynthetic process SoyBaseN/AISS
GO:0050665GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide biosynthetic process SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016759GO-mf Annotation by Michelle Graham. GO Molecular Function: cellulose synthase activity SoyBaseN/AISS
GO:0016760GO-mf Annotation by Michelle Graham. GO Molecular Function: cellulose synthase (UDP-forming) activity SoyBaseN/AISS
PTHR13301Panther X-BOX TRANSCRIPTION FACTOR-RELATED JGI ISS
PTHR13301:SF24Panther JGI ISS
PF03552PFAM Cellulose synthase JGI ISS
UniRef100_I0IJY6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cellulose synthase 3 (Fragment) n=2 Tax=Eucalyptus RepID=I0IJY6_9MYRT SoyBaseE_val: 2.00E-124ISS
UniRef100_UPI000233EDA6UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233EDA6 related cluster n=1 Tax=unknown RepID=UPI000233EDA6 SoyBaseE_val: 2.00E-146ISS

Expression Patterns of Glyma18g15580
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g15580 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma18g15580
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g15580
>Glyma18g15580.1   sequence type=CDS   gene model=Glyma18g15580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GATGATGAGAATGCTCAATTCTCAGTTGTTATTGCTGGTGGTCACTTTTGGCCTGTTAGTGGGGAGTTCCCAATAGCATCTCATTATGGGGATCAGATGTTAGCTTCTTCACTGCAAAATCGAGTGCACCCATATCCCGCGTTTGATCCTCGAAATGGAAAATGGGATGAAGCCAAAGAGGATAGAATGGATGACTGGAAGTTGCAACAAGGCAATTTGGGGCCTGAACCTGATGAAGATCCAGATGCAGCCATGTTAGATGAAGCAAGGCAACCATTGTCAAGGAAGGTACCAATAGCATCCAGCAAAGTGAATCCATATAGGATGGTGATCGTGGCACGACTTGTTATCCTTGCCTTCTTCCTTCGATATAGACTTATGAATCCTATACATGATGCAATGGGACTGTGGCTAACTTCTATTATATGTGAAATCTGGTTTGCTTTTTCAAGGATCCTTGATCAGCTTCCCAAATGGTATCCCATTGATCGAGAAACATACCTTGATCATCTTTCAATTAGGTATGAACGTGAAGGTGAACCTAACATGCTTGCTCCAGTGGATGTCTTTGTTAGTACTGTGGATCCCATGAAAGAACCTCCTTTGGTTATAGCCAACATTGTTCTTTCAATCTTGGCCATGGATTACCCAGTTGGTAAGATATTGTGTTACATTTTTGATGATGGAGCTTCAATGTGTACACTTTCCTTATGTTGGAATAAACCTCTCAATTGGAAGGGATCACCAGATCCCTGTAATGATGGTTGGGATGGAATCAAGTGCATCAACTCACGCGAGCTTTCAGAAGATATCGGGTTACTGTCTGAATTGGAGACGCTATACGTTTTTAATTTATTGCACTCAGCATGCTTTTGCGATAAATTATTTATGATCTTATCCCTTTTGATTTCCTTGTTTCTGATTTGTAGAGACCTCTCTCACAGTAAGGGCTTAACTGGTTCACTTCCACATTCAATTGGAAATTTGACCAAGTTGTCAAACTTTCAAAATTGTTCCAAATGCAATTGCTCAATTATCTCATTTTCCGCTTAA
Predicted protein sequences of Glyma18g15580
>Glyma18g15580.1   sequence type=predicted peptide   gene model=Glyma18g15580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
DDENAQFSVVIAGGHFWPVSGEFPIASHYGDQMLASSLQNRVHPYPAFDPRNGKWDEAKEDRMDDWKLQQGNLGPEPDEDPDAAMLDEARQPLSRKVPIASSKVNPYRMVIVARLVILAFFLRYRLMNPIHDAMGLWLTSIICEIWFAFSRILDQLPKWYPIDRETYLDHLSIRYEREGEPNMLAPVDVFVSTVDPMKEPPLVIANIVLSILAMDYPVGKILCYIFDDGASMCTLSLCWNKPLNWKGSPDPCNDGWDGIKCINSRELSEDIGLLSELETLYVFNLLHSACFCDKLFMILSLLISLFLICRDLSHSKGLTGSLPHSIGNLTKLSNFQNCSKCNCSIISFSA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo