Report for Sequence Feature Glyma18g15480
Feature Type: gene_model
Chromosome: Gm18
Start: 15551079
stop: 15554993
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g15480
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G69700 AT
Annotation by Michelle Graham. TAIR10: HVA22 homologue C | chr1:26220337-26221663 FORWARD LENGTH=184
SoyBase E_val: 5.00E-71 ISS
GO:0009414 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to water deprivation
SoyBase N/A ISS
GO:0009737 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus
SoyBase N/A ISS
GO:0042538 GO-bp
Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0009506 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
KOG1725
KOG
Protein involved in membrane traffic (YOP1/TB2/DP1/HVA22 family)
JGI ISS
PTHR12300 Panther
HVA22-LIKE PROTEINS
JGI ISS
PTHR12300:SF11 Panther
HVA22-LIKE PROTEIN
JGI ISS
PF03134 PFAM
TB2/DP1, HVA22 family
JGI ISS
UniRef100_G7KCI8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: HVA22-like protein c n=1 Tax=Medicago truncatula RepID=G7KCI8_MEDTR
SoyBase E_val: 2.00E-93 ISS
UniRef100_I1N164 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N164_SOYBN
SoyBase E_val: 4.00E-131 ISS
Expression Patterns of Glyma18g15480
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma18g15480
Paralog Evidence Comments
Glyma08g41060 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g15480 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g121600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g15480
Coding sequences of Glyma18g15480
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g15480.1 sequence type=CDS gene model=Glyma18g15480 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGGTGCTTCTGACGACAACAACAACAACTTTCTCCAAGTTGTCTTCAATAACTTTGATGTTCTTGCACTGCCCTTGGTTACGCTTGTTTACCCTTTATATGCTTCAATTAAGGCCATCGAGACCAAGTCTACTACTGACGATCAACAATGGCTCACGTATTGGATTCTGTATTCCATTCTCACAATCTTTGAGCTCACATTTGTCAAAGTTCTTGAACTGCTTCCCATTTGGCTTTTTGCCAAGTTGATATTCAGTTGCTGGTTGGTTCTGCCTCACTTCAATGGGGCTGCGGTTGTTTATAGGAATTACATCAGACCATTTTATATGAACCCCCAAATCCCAATTCCACAAGGCTCTCAAATCTGGTATTTTCCGCAAAAGAAGTCTTTATTCAATGAGCCAGACGATGTTCTAAGTGCTGCTGAGAGATACATGGAAGAGCATGGTACAGAAGCCATTGAAAGACTTATAAACAAGAATGACAGACAAGCTAGAGCAAGGAGGAATGGAAATTACATGATCTTTGATGATGACTACATATATTGA
Predicted protein sequences of Glyma18g15480
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g15480.1 sequence type=predicted peptide gene model=Glyma18g15480 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MGASDDNNNNFLQVVFNNFDVLALPLVTLVYPLYASIKAIETKSTTDDQQWLTYWILYSILTIFELTFVKVLELLPIWLFAKLIFSCWLVLPHFNGAAVVYRNYIRPFYMNPQIPIPQGSQIWYFPQKKSLFNEPDDVLSAAERYMEEHGTEAIERLINKNDRQARARRNGNYMIFDDDYIY*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
