SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g15451

Feature Type:gene_model
Chromosome:Gm18
Start:15535391
stop:15535769
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g15451
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G17230AT Annotation by Michelle Graham. TAIR10: PHYTOENE SYNTHASE | chr5:5659839-5662087 REVERSE LENGTH=422 SoyBaseE_val: 1.00E-25ISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0006655GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process SoyBaseN/AISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0010287GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule SoyBaseN/AISS
GO:0016740GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity SoyBaseN/AISS
GO:0016765GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring alkyl or aryl (other than methyl) groups SoyBaseN/AISS
GO:0016767GO-mf Annotation by Michelle Graham. GO Molecular Function: geranylgeranyl-diphosphate geranylgeranyltransferase activity SoyBaseN/AISS
GO:0046905GO-mf Annotation by Michelle Graham. GO Molecular Function: phytoene synthase activity SoyBaseN/AISS
PF00494PFAM Squalene/phytoene synthase JGI ISS
UniRef100_G7JA42UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phytoene synthase n=1 Tax=Medicago truncatula RepID=G7JA42_MEDTR SoyBaseE_val: 4.00E-31ISS
UniRef100_UPI000233E155UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E155 related cluster n=1 Tax=unknown RepID=UPI000233E155 SoyBaseE_val: 5.00E-39ISS

Expression Patterns of Glyma18g15451
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g15451 not represented in the dataset
Glyma18g15451 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g15451 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g121500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g15451
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g15451
>Glyma18g15451.1   sequence type=CDS   gene model=Glyma18g15451   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATACAAGGCATGAGAATGGATACAAGGAAAGCCCGATACAACAATTTCCAAGAGTTATATCTTTACTGCTACAATGTGGCGGGAACTGTGGGCTTAATGACTGTTCCAATAATGGGCATTGCCGAGGAGTCTGTCATCCCAGTTCAAAGTGTATATGATGCTGCACTATATCTGGGTGTAGGAAATCAACTCAAACATTCTTAG
Predicted protein sequences of Glyma18g15451
>Glyma18g15451.1   sequence type=predicted peptide   gene model=Glyma18g15451   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIQGMRMDTRKARYNNFQELYLYCYNVAGTVGLMTVPIMGIAEESVIPVQSVYDAALYLGVGNQLKHS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo