SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g15390

Feature Type:gene_model
Chromosome:Gm18
Start:15487415
stop:15487643
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g15390
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G18290AT Annotation by Michelle Graham. TAIR10: anaphase promoting complex 10 | chr2:7948522-7950096 REVERSE LENGTH=192 SoyBaseE_val: 2.00E-25ISS
GO:0007276GO-bp Annotation by Michelle Graham. GO Biological Process: gamete generation SoyBaseN/AISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0010087GO-bp Annotation by Michelle Graham. GO Biological Process: phloem or xylem histogenesis SoyBaseN/AISS
GO:0030071GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of mitotic metaphase/anaphase transition SoyBaseN/AISS
GO:0031145GO-bp Annotation by Michelle Graham. GO Biological Process: anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0032875GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA endoreduplication SoyBaseN/AISS
GO:0032876GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of DNA endoreduplication SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0051302GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell division SoyBaseN/AISS
GO:0051510GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of unidimensional cell growth SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005680GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anaphase-promoting complex SoyBaseN/AISS
GO:0016604GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nuclear body SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR12936Panther ANAPHASE-PROMOTING COMPLEX 10 JGI ISS
PF03256PFAM Anaphase-promoting complex, subunit 10 (APC10) JGI ISS
UniRef100_B9S6F0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Anaphase-promoting complex, putative n=1 Tax=Ricinus communis RepID=B9S6F0_RICCO SoyBaseE_val: 7.00E-24ISS
UniRef100_I1JW93UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JW93_SOYBN SoyBaseE_val: 1.00E-25ISS

Expression Patterns of Glyma18g15390
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g15390 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma18g15390
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g15390
>Glyma18g15390.1   sequence type=CDS   gene model=Glyma18g15390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CAGTTGATTGTGCTTTACGTGGTTTTCAAGCTTGATGAGAGTTACACGCCGAGCAAAGTTTCCATCCGTGCCGGTGATGGTTTTCACAACTTGAAGGAGATTAAGACCGTGGAACTCGTGAAGCCAACTGGGTGGGTTTATCTATCC
Predicted protein sequences of Glyma18g15390
>Glyma18g15390.1   sequence type=predicted peptide   gene model=Glyma18g15390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
QLIVLYVVFKLDESYTPSKVSIRAGDGFHNLKEIKTVELVKPTGWVYLS






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo