|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT2G18290 | AT | Annotation by Michelle Graham. TAIR10: anaphase promoting complex 10 | chr2:7948522-7950096 REVERSE LENGTH=192 | SoyBase | E_val: 2.00E-25 | ISS |
GO:0007276 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gamete generation | SoyBase | N/A | ISS |
GO:0008283 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell proliferation | SoyBase | N/A | ISS |
GO:0010087 | GO-bp | Annotation by Michelle Graham. GO Biological Process: phloem or xylem histogenesis | SoyBase | N/A | ISS |
GO:0030071 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of mitotic metaphase/anaphase transition | SoyBase | N/A | ISS |
GO:0031145 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process | SoyBase | N/A | ISS |
GO:0032875 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of DNA endoreduplication | SoyBase | N/A | ISS |
GO:0032876 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of DNA endoreduplication | SoyBase | N/A | ISS |
GO:0042023 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication | SoyBase | N/A | ISS |
GO:0043161 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process | SoyBase | N/A | ISS |
GO:0043248 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteasome assembly | SoyBase | N/A | ISS |
GO:0051302 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of cell division | SoyBase | N/A | ISS |
GO:0051510 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of unidimensional cell growth | SoyBase | N/A | ISS |
GO:0051788 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to misfolded protein | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0005680 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: anaphase-promoting complex | SoyBase | N/A | ISS |
GO:0016604 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nuclear body | SoyBase | N/A | ISS |
GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
PTHR12936 | Panther | ANAPHASE-PROMOTING COMPLEX 10 | JGI | ISS | |
PF03256 | PFAM | Anaphase-promoting complex, subunit 10 (APC10) | JGI | ISS | |
UniRef100_B9S6F0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Anaphase-promoting complex, putative n=1 Tax=Ricinus communis RepID=B9S6F0_RICCO | SoyBase | E_val: 7.00E-24 | ISS |
UniRef100_I1JW93 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1JW93_SOYBN | SoyBase | E_val: 1.00E-25 | ISS |
Glyma18g15390 not represented in the dataset |
Glyma18g15390 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g15390.1 sequence type=CDS gene model=Glyma18g15390 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high CAGTTGATTGTGCTTTACGTGGTTTTCAAGCTTGATGAGAGTTACACGCCGAGCAAAGTTTCCATCCGTGCCGGTGATGGTTTTCACAACTTGAAGGAGATTAAGACCGTGGAACTCGTGAAGCCAACTGGGTGGGTTTATCTATCC
>Glyma18g15390.1 sequence type=predicted peptide gene model=Glyma18g15390 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high QLIVLYVVFKLDESYTPSKVSIRAGDGFHNLKEIKTVELVKPTGWVYLS
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||