SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g15320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g15320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g15320

Feature Type:gene_model
Chromosome:Gm18
Start:15409856
stop:15410491
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G24090AT Annotation by Michelle Graham. TAIR10: chitinase A | chr5:8143805-8145153 REVERSE LENGTH=302 SoyBaseE_val: 1.00E-69ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009642GO-bp Annotation by Michelle Graham. GO Biological Process: response to light intensity SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0016926GO-bp Annotation by Michelle Graham. GO Biological Process: protein desumoylation SoyBaseN/AISS
GO:0042631GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation SoyBaseN/AISS
GO:0050665GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide biosynthetic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004553GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds SoyBaseN/AISS
GO:0043169GO-mf Annotation by Michelle Graham. GO Molecular Function: cation binding SoyBaseN/AISS
PF00704PFAM Glycosyl hydrolases family 18 JGI ISS
UniRef100_I1N160UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N160_SOYBN SoyBaseE_val: 1.00E-127ISS
UniRef100_Q6XD74UniRef Annotation by Michelle Graham. Most informative UniRef hit: Class III chitinase n=2 Tax=Medicago truncatula RepID=Q6XD74_MEDTR SoyBaseE_val: 2.00E-105ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g15320 not represented in the dataset

Glyma18g15320 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g120800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g15320.2   sequence type=CDS   gene model=Glyma18g15320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAATGAAATCAGCAATCACAGTCACATTCTTATCCTTAGTCTCTTTAGCACTAGCAAGTGATTCTGATGGTGGCATAATTGCAATCTATTGGGGCCAGAAAGATAACGAGGGCACGCTGGCCGAGGTTTGTGCCACAGGGAACTATGATTATGTGATCATAGCCTTTCTGCCAACCTTTGGAAATGGCCAAACTCCCATGATTTATCTTGCTGATCACTGTGACCCTTATAGTAATGGGTGCACTGGCTTAAGCTCAGACATCAAATCTTGTCAAGACAAAGGCATCAAGGTATTGCTTTCTTTGGTAGGAGGTGTTGGAAGCTACTCAGATACTAATTCCACTCAGGATGCATGTCAAGTAGCCGCTTACCTTTGGAACAACTTCTTGGGGGGACAGTCATCGTCTCGCCCTCTTGGCCCTGCTGTCCTTGATGGCTTTGATTTTGGTATTGTTTATGACATTGAAGGTGGACCAAAGCAGTACTGGCGTGATCTTGCCAAGTTCCTTAAATGGTATAACCCTAAAGTATACATAACTGTAGCACCTCAGTGCCCATTTCCTGATGTTTGGATAGGAAATTCCCTTACAACTGGCCTTTTTGACTTTGTTTGGTTCCCAATTCTACAATAG

>Glyma18g15320.2   sequence type=predicted peptide   gene model=Glyma18g15320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAMKSAITVTFLSLVSLALASDSDGGIIAIYWGQKDNEGTLAEVCATGNYDYVIIAFLPTFGNGQTPMIYLADHCDPYSNGCTGLSSDIKSCQDKGIKVLLSLVGGVGSYSDTNSTQDACQVAAYLWNNFLGGQSSSRPLGPAVLDGFDFGIVYDIEGGPKQYWRDLAKFLKWYNPKVYITVAPQCPFPDVWIGNSLTTGLFDFVWFPILQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo