Glyma18g15310 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g15310

Feature Type:	gene_model
Chromosome:	Gm18
Start:	15405765
stop:	15407234
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g15310

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G24090	AT	Annotation by Michelle Graham. TAIR10: chitinase A \| chr5:8143805-8145153 REVERSE LENGTH=302	SoyBase	E_val: 5.00E-130	ISS
GO:0005975	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009642	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to light intensity	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0010228	GO-bp	Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem	SoyBase	N/A	ISS
GO:0016926	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein desumoylation	SoyBase	N/A	ISS
GO:0042631	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation	SoyBase	N/A	ISS
GO:0050665	GO-bp	Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide biosynthetic process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004553	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds	SoyBase	N/A	ISS
GO:0043169	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cation binding	SoyBase	N/A	ISS
PF00704	PFAM	Glycosyl hydrolases family 18	JGI		ISS
UniRef100_I1N156	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N156_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q6XD74	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Class III chitinase n=2 Tax=Medicago truncatula RepID=Q6XD74_MEDTR	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma18g15310

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g15310 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g120700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g15310

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g15310

Limit To All Plant Sequences

>Glyma18g15310.2   sequence type=CDS   gene model=Glyma18g15310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATCGAAATCATCACTCTCAATCAGATTCTTGTGCTTACTCTTGTTAGCACTAGCAAATGGTTCTAATGCTGGCAAAATTGCAATCTACTGGGGCCAGAATGGCAACGAGGGCACGCTGGCCGAGGCTTGTGCCACGGGGAACTATGATTATGTGATCATAGCCTTTTTGCCAACCTTTGGCAATGGCCAAACTCCTATGATTAACCTTGCTGGTCATTGTGATCCATACAGTAATGGTTGCACTGGATTAAGCTCTGACATCAAATCTTGTCAAGCCAAAGGCATCAAAGTATTGCTCTCTCTAGGAGGAGGTGCTGGAAGCTACTCAATTGCATCAACTCAAGATGCAAGCCAAGTAGCCACTTACCTTTGGAACAACTTCTTGGGGGGACAGTCATCGTCTCGCCCTCTTGGCCCCGCCGTTCTTGATGGCATTGATTTTGACATTGAAGGTGGATCAAACCAACACTGGGGTGATCTTGCCAAGTTCCTTAAAGGGTATGGAAAGCAAGTGTACATTACTGCAGCACCTCAGTGCCCATTTCCTGATGCTTGGATCGGAAATGCTCTCACAACAGGCCTTTTTGACTTTGTTTGGGTCCAATTCTACAACAACCCTCCTTGCCAATACAATTCTGGGGCAATTAGTAACCTTGAAGATGCATGGAAGCAATGGATCACAAGTATCCCTGCCAACAAGATATTCTTGGGGTTACCAGCTTCTCCACTGGCAGCAGGAAGTGGTTTCATTCCTCCTGCTGATGTTACATCCAAGGTGCTTCCAGCCATTAAGGGTTCTTCTAAATATGGAGGTGTTATGCTGTGGTCAAGGTATTATGATGTTCAGAGTGGTTACAGCTCTTCTATTAAGAAATATGTTTGA

Predicted protein sequences of Glyma18g15310

Limit To All Plant Sequences

>Glyma18g15310.2   sequence type=predicted peptide   gene model=Glyma18g15310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASKSSLSIRFLCLLLLALANGSNAGKIAIYWGQNGNEGTLAEACATGNYDYVIIAFLPTFGNGQTPMINLAGHCDPYSNGCTGLSSDIKSCQAKGIKVLLSLGGGAGSYSIASTQDASQVATYLWNNFLGGQSSSRPLGPAVLDGIDFDIEGGSNQHWGDLAKFLKGYGKQVYITAAPQCPFPDAWIGNALTTGLFDFVWVQFYNNPPCQYNSGAISNLEDAWKQWITSIPANKIFLGLPASPLAAGSGFIPPADVTSKVLPAIKGSSKYGGVMLWSRYYDVQSGYSSSIKKYV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain