SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g15280

Feature Type:gene_model
Chromosome:Gm18
Start:15388904
stop:15389871
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g15280
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G35050AT Annotation by Michelle Graham. TAIR10: Transducin family protein / WD-40 repeat family protein | chr4:16682752-16684751 REVERSE LENGTH=424 SoyBaseE_val: 2.00E-16ISS
GO:0006396GO-bp Annotation by Michelle Graham. GO Biological Process: RNA processing SoyBaseN/AISS
GO:0006406GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA export from nucleus SoyBaseN/AISS
GO:0006606GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into nucleus SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009560GO-bp Annotation by Michelle Graham. GO Biological Process: embryo sac egg cell differentiation SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009933GO-bp Annotation by Michelle Graham. GO Biological Process: meristem structural organization SoyBaseN/AISS
GO:0010074GO-bp Annotation by Michelle Graham. GO Biological Process: maintenance of meristem identity SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010182GO-bp Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0019915GO-bp Annotation by Michelle Graham. GO Biological Process: lipid storage SoyBaseN/AISS
GO:0022402GO-bp Annotation by Michelle Graham. GO Biological Process: cell cycle process SoyBaseN/AISS
GO:0050826GO-bp Annotation by Michelle Graham. GO Biological Process: response to freezing SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0080008GO-cc Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR22850Panther WD40 REPEAT FAMILY JGI ISS
PTHR22850:SF43Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_G7JMD2UniRef Annotation by Michelle Graham. Most informative UniRef hit: WD-40 repeat-containing protein MSI3 n=1 Tax=Medicago truncatula RepID=G7JMD2_MEDTR SoyBaseE_val: 2.00E-17ISS
UniRef100_I1LPT2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LPT2_SOYBN SoyBaseE_val: 2.00E-23ISS

Expression Patterns of Glyma18g15280
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g15280 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g120500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g15280
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g15280
>Glyma18g15280.1   sequence type=CDS   gene model=Glyma18g15280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTGGTCCAACAGTAAGGTACACACTAGTTTTATTGTGCGTGTGCGTGTGTTTGGATCAATTTGCCTATGCTGCTCAACTAATTATGAGCAAAGGTCATGAGAATGTGGTTGAAGATGTGCCATGGAATTTGAAGGATGAGAATATGTTTGGGTCTAGTGAAGATGACTGCAAATTGATCATTTGGGACTTGCGGACGAACAAAGCCCAACAATCAGTCAAACCACATGAAAAGGAGAATAGATTTAGTACAAGTCTTATTCTTAAATGGTTAAAAGTTCAGCAGTATGAGTCTGATGACTCTGATGAGAAAGACTTTGGCAGGGTGAAATTTTTTCTCTCTCATAAAAATGAAGAGAGCTGCTCTTGGAGTAGGTGA
Predicted protein sequences of Glyma18g15280
>Glyma18g15280.1   sequence type=predicted peptide   gene model=Glyma18g15280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFGPTVRYTLVLLCVCVCLDQFAYAAQLIMSKGHENVVEDVPWNLKDENMFGSSEDDCKLIIWDLRTNKAQQSVKPHEKENRFSTSLILKWLKVQQYESDDSDEKDFGRVKFFLSHKNEESCSWSR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo