SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g15130

Feature Type:gene_model
Chromosome:Gm18
Start:15153445
stop:15156832
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g15130
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G09270AT Annotation by Michelle Graham. TAIR10: importin alpha isoform 4 | chr1:2994506-2997833 FORWARD LENGTH=538 SoyBaseE_val: 4.00E-126ISS
GO:0006007GO-bp Annotation by Michelle Graham. GO Biological Process: glucose catabolic process SoyBaseN/AISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0006606GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into nucleus SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006820GO-bp Annotation by Michelle Graham. GO Biological Process: anion transport SoyBaseN/AISS
GO:0006862GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide transport SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0006888GO-bp Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0015696GO-bp Annotation by Michelle Graham. GO Biological Process: ammonium transport SoyBaseN/AISS
GO:0015802GO-bp Annotation by Michelle Graham. GO Biological Process: basic amino acid transport SoyBaseN/AISS
GO:0030581GO-bp Annotation by Michelle Graham. GO Biological Process: symbiont intracellular protein transport in host SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0043090GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid import SoyBaseN/AISS
GO:0043269GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of ion transport SoyBaseN/AISS
GO:0080034GO-bp Annotation by Michelle Graham. GO Biological Process: host response to induction by symbiont of tumor, nodule or growth in host SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008565GO-mf Annotation by Michelle Graham. GO Molecular Function: protein transporter activity SoyBaseN/AISS
KOG0166 KOG Karyopherin (importin) alpha JGI ISS
PTHR23316Panther IMPORTIN ALPHA-RELATED JGI ISS
PF00514PFAM Armadillo/beta-catenin-like repeat JGI ISS
UniRef100_I1N2F3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Importin subunit alpha (Fragment) n=1 Tax=Glycine max RepID=I1N2F3_SOYBN SoyBaseE_val: 2.00E-135ISS
UniRef100_UPI000233DFFEUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233DFFE related cluster n=1 Tax=unknown RepID=UPI000233DFFE SoyBaseE_val: 0ISS

Expression Patterns of Glyma18g15130
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g15130 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g119800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g15130
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g15130
>Glyma18g15130.2   sequence type=CDS   gene model=Glyma18g15130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCACTGCAACCTGGTTCTGGTTCTGGTTCTGGTTCTGATTCTGGTTCTGGTTCTGAGAAGAGGAAGAAAAGCTATGACAGTGAAATCAATCTCGTCGATGACACCCCCCTCAAGAAAGGAAGAAGAGAAGAATTGTCTTCAGAAATCCCTTCCAAAGAAAAGCTTTTGGAAGCTATTCCCGAGATGAAGCAACGTATATGGTCTGAGTGCCCTGACGAACAAATGGACGCAATGATGCACTTTACAAATCTGTTAGGATCTATAGAGCCCCCTCGTCCAATTGATGAGGTGATTGAGGCAGAAGTTGTCCCTCGCTTTGTGCAATTCTTGGATATGTATGATAAACCCGACTTGCAGTTTGAAGCTGTATGGTCGTTAACCAATATTGCTAGCGGAAAATCCCATCACACAAGAGTTGTCGTTGAACATGGCGCAGTTCCCTTGTTGGTGAAACTTCTCATCCTTAGCAACAATGAGGACGTCATAGAACAGGTAGTATGGGCTATAAGTAACATTGCTGGTGAATCCCCAAAATATAGGGATCTTGTTCTTGAGGAAGGTGTTCTTCTACCGTTAATATCTCTGTTGGGTCCACCACTTCCAACAATGTCTATGTTGTTGACTACTACATGGACTTTATCTAATTTGGTCCGTGGAAAGCCTCACGTACAATTTAAACAGGTAGAGCCTCTCATGCCTGTCCTTAAGACACTCATCGACATGGACAACGAAGAAGTTTTATTAAATGCATGCAGTGCTCTTTATTTCCTTTCAAATGTCTCAGCTGGCGCAACTCAGGCTATTATCGAAGCAGAAGTTTGCCCAAAACTAGTGGAGCTTTTGCTGTATTCATCAGATTCAGTTAGTTTACTTGCACTTCAGACTTTGGGAAACATCGCTGCTGGTAATGATGCTCAGACTCAGCATGTAATTGATAACCAATTTCTCCCACCTGTTCGTCTACTTCTTTTTCTCACGCGAGAACGAAATGAAATCATCTTCAGAAAAGCTTGTTGGGCAATCTCAAATATCACAGCTGGTAATAGAACTCAAATACAGGCAGTGATTGATGCCGAAATTTTTCCTATTCTTGTTGGGTTTTTTTGTCATCATCATGCTGACTCTGATTTTGATATCAAGAAAGAGGTGGTCTGGGCCATCACCAATGCCACTAGAAGAGGATCTGCTGACCAAATCATGGACCTGGCGGATCAAGGTTGCGCTAAGCCTCTAAGTGAACTCTTGACCCATCCAAACCCAGAAATTGTGTCAATTTGTGTCGAGGGGCTACAGAAAATTTTGATGGCTCGGATAAGCCAACAACAACGAAGATAG
Predicted protein sequences of Glyma18g15130
>Glyma18g15130.2   sequence type=predicted peptide   gene model=Glyma18g15130   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLQPGSGSGSGSDSGSGSEKRKKSYDSEINLVDDTPLKKGRREELSSEIPSKEKLLEAIPEMKQRIWSECPDEQMDAMMHFTNLLGSIEPPRPIDEVIEAEVVPRFVQFLDMYDKPDLQFEAVWSLTNIASGKSHHTRVVVEHGAVPLLVKLLILSNNEDVIEQVVWAISNIAGESPKYRDLVLEEGVLLPLISLLGPPLPTMSMLLTTTWTLSNLVRGKPHVQFKQVEPLMPVLKTLIDMDNEEVLLNACSALYFLSNVSAGATQAIIEAEVCPKLVELLLYSSDSVSLLALQTLGNIAAGNDAQTQHVIDNQFLPPVRLLLFLTRERNEIIFRKACWAISNITAGNRTQIQAVIDAEIFPILVGFFCHHHADSDFDIKKEVVWAITNATRRGSADQIMDLADQGCAKPLSELLTHPNPEIVSICVEGLQKILMARISQQQRR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo