SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g15110

Feature Type:gene_model
Chromosome:Gm18
Start:15147363
stop:15148202
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g15110
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G37020AT Annotation by Michelle Graham. TAIR10: auxin response factor 8 | chr5:14630151-14633916 FORWARD LENGTH=773 SoyBaseE_val: 2.00E-63ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009725GO-bp Annotation by Michelle Graham. GO Biological Process: response to hormone stimulus SoyBaseN/AISS
GO:0009733GO-bp Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus SoyBaseN/AISS
GO:0009855GO-bp Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry SoyBaseN/AISS
GO:0009886GO-bp Annotation by Michelle Graham. GO Biological Process: post-embryonic morphogenesis SoyBaseN/AISS
GO:0009887GO-bp Annotation by Michelle Graham. GO Biological Process: organ morphogenesis SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0010051GO-bp Annotation by Michelle Graham. GO Biological Process: xylem and phloem pattern formation SoyBaseN/AISS
GO:0010154GO-bp Annotation by Michelle Graham. GO Biological Process: fruit development SoyBaseN/AISS
GO:0048439GO-bp Annotation by Michelle Graham. GO Biological Process: flower morphogenesis SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0048507GO-bp Annotation by Michelle Graham. GO Biological Process: meristem development SoyBaseN/AISS
GO:0048519GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0046983GO-mf Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity SoyBaseN/AISS
UniRef100_G7KFN6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin response factor n=1 Tax=Medicago truncatula RepID=G7KFN6_MEDTR SoyBaseE_val: 2.00E-61ISS
UniRef100_UPI000233F592UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F592 related cluster n=1 Tax=unknown RepID=UPI000233F592 SoyBaseE_val: 7.00E-64ISS

Expression Patterns of Glyma18g15110
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g15110 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g119700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g15110
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g15110
>Glyma18g15110.1   sequence type=CDS   gene model=Glyma18g15110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCTTTCAACATCAGGGTTGGGGCAGCAGGGACATGAAGGAGAGGAGAAGAAGTGTCTGAATTCTGAGCTATGGCATGCATGCACGGGCCCCCTAGTGTCCCTACCAACTTCAGGGACTCGTGTGGTTTACTTCCCTCAGGGTCATAGTGAGCAGGTTGCTGCCACAACTAACAGAGAAATTGATGGACACATTCCCAATTACCCTAGCTTGCCACCCCAGTTGATTTGCCAACTTCATAATGTCACAATGCATGCAGATGTTGAAACGGATGAAGTATATGCTCAAATGACATTGCAACCATTGACTCTGGTATCCTTTTGTTCTTTAATTAGCTCAATGTATGTGTTGTGA
Predicted protein sequences of Glyma18g15110
>Glyma18g15110.1   sequence type=predicted peptide   gene model=Glyma18g15110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKLSTSGLGQQGHEGEEKKCLNSELWHACTGPLVSLPTSGTRVVYFPQGHSEQVAATTNREIDGHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTLVSFCSLISSMYVL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo