Glyma18g15100 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g15100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g15100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g15100

Feature Type:	gene_model
Chromosome:	Gm18
Start:	15144927
stop:	15145574
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g15100

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G51630	AT	Annotation by Michelle Graham. TAIR10: O-fucosyltransferase family protein \| chr1:19142141-19144082 REVERSE LENGTH=423	SoyBase	E_val: 3.00E-47	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005768	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endosome	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005802	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network	SoyBase	N/A	ISS
GO:0009505	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
UniRef100_I1KG57	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KG57_SOYBN	SoyBase	E_val: 5.00E-80	ISS
UniRef100_Q0WPA5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: O-fucosyltransferase family protein n=1 Tax=Arabidopsis thaliana RepID=Q0WPA5_ARATH	SoyBase	E_val: 1.00E-44	ISS

Expression Patterns of Glyma18g15100

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g15100 not represented in the dataset	Glyma18g15100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g15100 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g15100

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g15100

Limit To All Plant Sequences

>Glyma18g15100.1   sequence type=CDS   gene model=Glyma18g15100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACTTTGAGGACATTTACGATGTCGATGTGTTCATGAAAAGAATGGAAGAAGTGGTCAGAGTGTTAAAGGATCTTCCTTCTCATGTTCCTAAGGGGAGTGTCAGGCTTGCTACTTATTTCCCTTCAATAAACATGAGAAAAGTAGGTGAAAAAAGTGATCTTAGAGTTGCAGCAAGAACGCATGACCTTGTTGACTCAATGGTTGAAAGACTTAGGACTTTAAGTCGAAAGTCAGATGGCCAATTTATAGTTATGGATCTGAGGGTTGAGATGTTGGATAAGAAGGGTTGTCAAGGAAGGGATAGTGAAAAAGAGGAGAGTTGCTTCAATGCACAAGAGGATACTACAATCTATGTGACACAATCAAGGTGGGATGAAAGCCTTGACTCTCTTAAAGATTTGTTCCCTAAAACATATACAAAGGAATCCATCATTCCTGCAGATAAGAAGAAA

Predicted protein sequences of Glyma18g15100

Limit To All Plant Sequences

>Glyma18g15100.1   sequence type=predicted peptide   gene model=Glyma18g15100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNFEDIYDVDVFMKRMEEVVRVLKDLPSHVPKGSVRLATYFPSINMRKVGEKSDLRVAARTHDLVDSMVERLRTLSRKSDGQFIVMDLRVEMLDKKGCQGRDSEKEESCFNAQEDTTIYVTQSRWDESLDSLKDLFPKTYTKESIIPADKKK

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain