SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g15100

Feature Type:gene_model
Chromosome:Gm18
Start:15144927
stop:15145574
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g15100
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G51630AT Annotation by Michelle Graham. TAIR10: O-fucosyltransferase family protein | chr1:19142141-19144082 REVERSE LENGTH=423 SoyBaseE_val: 3.00E-47ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005768GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endosome SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005802GO-cc Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network SoyBaseN/AISS
GO:0009505GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall SoyBaseN/AISS
GO:0016757GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups SoyBaseN/AISS
UniRef100_I1KG57UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KG57_SOYBN SoyBaseE_val: 5.00E-80ISS
UniRef100_Q0WPA5UniRef Annotation by Michelle Graham. Most informative UniRef hit: O-fucosyltransferase family protein n=1 Tax=Arabidopsis thaliana RepID=Q0WPA5_ARATH SoyBaseE_val: 1.00E-44ISS

Expression Patterns of Glyma18g15100
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g15100 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma18g15100
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g15100
>Glyma18g15100.1   sequence type=CDS   gene model=Glyma18g15100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACTTTGAGGACATTTACGATGTCGATGTGTTCATGAAAAGAATGGAAGAAGTGGTCAGAGTGTTAAAGGATCTTCCTTCTCATGTTCCTAAGGGGAGTGTCAGGCTTGCTACTTATTTCCCTTCAATAAACATGAGAAAAGTAGGTGAAAAAAGTGATCTTAGAGTTGCAGCAAGAACGCATGACCTTGTTGACTCAATGGTTGAAAGACTTAGGACTTTAAGTCGAAAGTCAGATGGCCAATTTATAGTTATGGATCTGAGGGTTGAGATGTTGGATAAGAAGGGTTGTCAAGGAAGGGATAGTGAAAAAGAGGAGAGTTGCTTCAATGCACAAGAGGATACTACAATCTATGTGACACAATCAAGGTGGGATGAAAGCCTTGACTCTCTTAAAGATTTGTTCCCTAAAACATATACAAAGGAATCCATCATTCCTGCAGATAAGAAGAAA
Predicted protein sequences of Glyma18g15100
>Glyma18g15100.1   sequence type=predicted peptide   gene model=Glyma18g15100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNFEDIYDVDVFMKRMEEVVRVLKDLPSHVPKGSVRLATYFPSINMRKVGEKSDLRVAARTHDLVDSMVERLRTLSRKSDGQFIVMDLRVEMLDKKGCQGRDSEKEESCFNAQEDTTIYVTQSRWDESLDSLKDLFPKTYTKESIIPADKKK






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo