Glyma18g14930 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g14930): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g14930): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g14930

Feature Type:	gene_model
Chromosome:	Gm18
Start:	14916013
stop:	14918004
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g14930

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G20430	AT	Annotation by Michelle Graham. TAIR10: Subtilase family protein \| chr4:11017656-11021105 REVERSE LENGTH=832	SoyBase	E_val: 4.00E-20	ISS
GO:0000911	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation	SoyBase	N/A	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0043086	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of catalytic activity	SoyBase	N/A	ISS
GO:0051322	GO-bp	Annotation by Michelle Graham. GO Biological Process: anaphase	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0004252	GO-mf	Annotation by Michelle Graham. GO Molecular Function: serine-type endopeptidase activity	SoyBase	N/A	ISS
GO:0042802	GO-mf	Annotation by Michelle Graham. GO Molecular Function: identical protein binding	SoyBase	N/A	ISS
PTHR11937	Panther	ACTIN	JGI		ISS
PTHR11937:SF77	Panther	ACTIN	JGI		ISS
PF00022	PFAM	Actin	JGI		ISS
UniRef100_G7L9K7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Serine protease aprX n=1 Tax=Medicago truncatula RepID=G7L9K7_MEDTR	SoyBase	E_val: 1.00E-19	ISS
UniRef100_UPI000233DFF6	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233DFF6 related cluster n=1 Tax=unknown RepID=UPI000233DFF6	SoyBase	E_val: 1.00E-42	ISS

Expression Patterns of Glyma18g14930

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g14930 not represented in the dataset	Glyma18g14930 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g14930 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g14930

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g14930

Limit To All Plant Sequences

>Glyma18g14930.1   sequence type=CDS   gene model=Glyma18g14930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATGAATATGATGGGAAGGGAAACATCACTTCAAATTTCAAACAAGTTCTCACAAGTTTCCCTGATTGTCAGATTATAATTACAACATATGATTTCTCTGTTTTCAAATACAGGCGGTGGGGAGAAAAGGACCAAAATTTGGATAATATTAGTTGTTGTGGTGGGGCAGAGAAACTATCAAGGAGCAATGAAGTGTCCAATGTGATTTTCAATTTTTCTGTAAGGACTGCGACTATGCAGACACCACAGTTTTTGGGTCTGCCACAGGGAGCATGGTTTCAAGATGGTGGGTTCGAGACTGTTGGAGAAGGAGTTGTTATAGGGTTTGTTGATAACTTTTGCGTTGTTAGACATGACTTTTTGATGACGAAAAAGGAATGGGGTTTTGAACATGAAACCAAGTGCACTCTTGACCACAGTTACTACATAGTATGTAGTAACTTGAAGTATCAAATTAGACATACACATGAAATTTCAAACTGGGCAGATGCTAAATACATTTTGTCCACAAGAATTAATTATTTCACTTTCCAGCTGTTTGGAGAGTTTGGAAATCATTTTGGAAATACTGACATCAAGAAGGACCTCTATGGTAACATTGTGGTGATGGCTCAACAATGTTCCATCACAACATTAGCACCAAGCAGCATGAAAATTAAGGTGGTGGCACCACCAAAGAGGAAGTACAGTGTCTGGATTAGAGGCTCCATTTTGGCATCCCTCAACACCTTCCAATAG

Predicted protein sequences of Glyma18g14930

Limit To All Plant Sequences

>Glyma18g14930.1   sequence type=predicted peptide   gene model=Glyma18g14930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHEYDGKGNITSNFKQVLTSFPDCQIIITTYDFSVFKYRRWGEKDQNLDNISCCGGAEKLSRSNEVSNVIFNFSVRTATMQTPQFLGLPQGAWFQDGGFETVGEGVVIGFVDNFCVVRHDFLMTKKEWGFEHETKCTLDHSYYIVCSNLKYQIRHTHEISNWADAKYILSTRINYFTFQLFGEFGNHFGNTDIKKDLYGNIVVMAQQCSITTLAPSSMKIKVVAPPKRKYSVWIRGSILASLNTFQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain