SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g14921

Feature Type:gene_model
Chromosome:Gm18
Start:14913056
stop:14914399
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G69780AT Annotation by Michelle Graham. TAIR10: Homeobox-leucine zipper protein family | chr1:26259166-26260465 FORWARD LENGTH=294 SoyBaseE_val: 9.00E-50ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0048826GO-bp Annotation by Michelle Graham. GO Biological Process: cotyledon morphogenesis SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0000976GO-mf Annotation by Michelle Graham. GO Molecular Function: transcription regulatory region sequence-specific DNA binding SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PTHR24326Panther FAMILY NOT NAMED JGI ISS
PTHR24326:SF223Panther JGI ISS
PF02183PFAM Homeobox associated leucine zipper JGI ISS
UniRef100_B9S292UniRef Annotation by Michelle Graham. Most informative UniRef hit: Homeobox protein, putative n=1 Tax=Ricinus communis RepID=B9S292_RICCO SoyBaseE_val: 2.00E-83ISS
UniRef100_UPI000233DFF6UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233DFF6 related cluster n=1 Tax=unknown RepID=UPI000233DFF6 SoyBaseE_val: 3.00E-110ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g14921 not represented in the dataset

Glyma18g14921 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g118500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g14921.1   sequence type=CDS   gene model=Glyma18g14921   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATAGGAAGGCTAGGTGGAAGACCAAGCAGTTGGAGAAGGACTATGATCTTCTCAAAAGACAATATGATGCTATCAAGGCAGATAATGATGCACTTCAAGCTCAGAACCAAAAACTTCAAACTGAGATATTGGCACTGAAAAGCAGAGAACCAACTGAATCCATCAACCTCAACAAAGAAACTGACGGATCCAGCAGCAATAGAAGTGAGAACAGCTCAGAGATCAACTTGGATATCTCAAGAACACCAGCTATTGACAGTTCTCTATCCACTCAGCAGAGCAACAACAAAACCTTCTTTCCATCTTCTGCTAGACCAACAGGAGTGGCTCAACTTTTCCAAACCACTTCAAGGCCAGAGATTCAGTGCCAAAAGATTGATCACATGGTCAACGAAGAGAGCTTAAGCAACATGTTTTGTGGCATTGATGATCAATCTGGCCTTTGGCCTTGGTTGGAGCAGCAACATTTCAATTGA

>Glyma18g14921.1   sequence type=predicted peptide   gene model=Glyma18g14921   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNRKARWKTKQLEKDYDLLKRQYDAIKADNDALQAQNQKLQTEILALKSREPTESINLNKETDGSSSNRSENSSEINLDISRTPAIDSSLSTQQSNNKTFFPSSARPTGVAQLFQTTSRPEIQCQKIDHMVNEESLSNMFCGIDDQSGLWPWLEQQHFN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo