SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g14900

Feature Type:gene_model
Chromosome:Gm18
Start:14886072
stop:14887079
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g14900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G12340AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G28190.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:3992948-3993610 REVERSE LENGTH=220 SoyBaseE_val: 7.00E-53ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1N143UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N143_SOYBN SoyBaseE_val: 9.00E-143ISS
UniRef100_Q10L85UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q10L85_ORYSJ SoyBaseE_val: 1.00E-36ISS

Expression Patterns of Glyma18g14900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g14900 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g118300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g14900
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g14900
>Glyma18g14900.1   sequence type=CDS   gene model=Glyma18g14900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAATGCCGCAGTGACTCCATGCTTTCATCCAAAGAATTCCTCGTCATCGTCATCGTCGAAACTTATTTTTTGGGATGGCACCATGAGGTGTCTCAAGGGTAAGCACATTGCTGGTGAGATCATGTATGAGTTTCCAGACAAGGTAGTTTGCCATGCAGATTCTTTCTTCATTGGACACCCAATTCCTGCTTTAGCTTTAGAGGATGAGCTCATTCAAGGTGAAGCTTATTTTGTTCTCCCCATTGATAGCTTCACATGCAAAACCCTTTCTATTTCTTCACTCTTGTCCTTGGGATCAGACCCTAGCAAGTCCACCATCAAATTTGGGGAATGCCCTTTTGAGTACTTGAAAGGTTCCAATGGAAGGGTGTTGATAAAGGTCATGCCCGAGTTCATCACAAGGCTAATCAATAGAAGTAAAAGACCTTGTTGCCCCAGCAGCAACGACAACAACAACTTCCTATGCAGCACTCCTGAGTTGAGAAAACACTACCAAATGCTAGTGAAATCCAAGGACCAAGTTTGGTCACCTAAGCTTGAAACCATTTCGGAAAACAAGGTTAGGTTTTCACCGTGTAGATTTATATAG
Predicted protein sequences of Glyma18g14900
>Glyma18g14900.1   sequence type=predicted peptide   gene model=Glyma18g14900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGNAAVTPCFHPKNSSSSSSSKLIFWDGTMRCLKGKHIAGEIMYEFPDKVVCHADSFFIGHPIPALALEDELIQGEAYFVLPIDSFTCKTLSISSLLSLGSDPSKSTIKFGECPFEYLKGSNGRVLIKVMPEFITRLINRSKRPCCPSSNDNNNFLCSTPELRKHYQMLVKSKDQVWSPKLETISENKVRFSPCRFI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo