Glyma18g14801 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g14801

Feature Type:	gene_model
Chromosome:	Gm18
Start:	14753241
stop:	14757380
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g14801

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G07910	AT	Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Reactive oxygen species modulator 1 (InterPro:IPR018450); Has 192 Blast hits to 192 proteins in 80 species: Archae - 0; Bacteria - 0; Metazoa - 139; Fungi - 6; Plants - 39; Viruses - 0; Other Eukaryotes - 8 (source: NCBI BLink). \| chr3:2523367-2524048 REVERSE LENGTH=74	SoyBase	E_val: 8.00E-27	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG4096	KOG	Uncharacterized conserved protein	JGI		ISS
PF10247	PFAM	Reactive mitochondrial oxygen species modulator 1	JGI		ISS
UniRef100_Q9SFC3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AT3g07910/F17A17_25 n=1 Tax=Arabidopsis thaliana RepID=Q9SFC3_ARATH	SoyBase	E_val: 4.00E-24	ISS
UniRef100_UPI000233E6DA	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E6DA related cluster n=1 Tax=unknown RepID=UPI000233E6DA	SoyBase	E_val: 4.00E-43	ISS

Expression Patterns of Glyma18g14801

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g14801 not represented in the dataset	Glyma18g14801 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g14801

Paralog	Evidence	Comments
Glyma08g41416	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g14801 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g117700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g14801

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g14801

Limit To All Plant Sequences

>Glyma18g14801.1   sequence type=CDS   gene model=Glyma18g14801   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAGGGACAGTTGCCTCGCTCGTGTCACCGCCGGCGCCGCTATGGGCGGCGCTGTCGGCGGCGCCGTCGGTGCTGTGTATGGAACATATGAAGCTATTAGGTATAAGGTGCCTGGACTATTGAAAATTAGGCATATTGGACAAACTACACTTGGAAGTGCTGCTATTTTTGGTCTTTTCTTGGGTGCTGGAAGCTTGATACATTGTGGGAAATCATACTGA

Predicted protein sequences of Glyma18g14801

Limit To All Plant Sequences

>Glyma18g14801.1   sequence type=predicted peptide   gene model=Glyma18g14801   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MARDSCLARVTAGAAMGGAVGGAVGAVYGTYEAIRYKVPGLLKIRHIGQTTLGSAAIFGLFLGAGSLIHCGKSY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain