SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g14801): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g14801): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g14801

Feature Type:gene_model
Chromosome:Gm18
Start:14753241
stop:14757380
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G07910AT Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Reactive oxygen species modulator 1 (InterPro:IPR018450); Has 192 Blast hits to 192 proteins in 80 species: Archae - 0; Bacteria - 0; Metazoa - 139; Fungi - 6; Plants - 39; Viruses - 0; Other Eukaryotes - 8 (source: NCBI BLink). | chr3:2523367-2524048 REVERSE LENGTH=74 SoyBaseE_val: 8.00E-27ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG4096 KOG Uncharacterized conserved protein JGI ISS
PF10247PFAM Reactive mitochondrial oxygen species modulator 1 JGI ISS
UniRef100_Q9SFC3UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT3g07910/F17A17_25 n=1 Tax=Arabidopsis thaliana RepID=Q9SFC3_ARATH SoyBaseE_val: 4.00E-24ISS
UniRef100_UPI000233E6DAUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E6DA related cluster n=1 Tax=unknown RepID=UPI000233E6DA SoyBaseE_val: 4.00E-43ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g14801 not represented in the dataset

Glyma18g14801 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g41416 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g117700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g14801.1   sequence type=CDS   gene model=Glyma18g14801   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAGGGACAGTTGCCTCGCTCGTGTCACCGCCGGCGCCGCTATGGGCGGCGCTGTCGGCGGCGCCGTCGGTGCTGTGTATGGAACATATGAAGCTATTAGGTATAAGGTGCCTGGACTATTGAAAATTAGGCATATTGGACAAACTACACTTGGAAGTGCTGCTATTTTTGGTCTTTTCTTGGGTGCTGGAAGCTTGATACATTGTGGGAAATCATACTGA

>Glyma18g14801.1   sequence type=predicted peptide   gene model=Glyma18g14801   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MARDSCLARVTAGAAMGGAVGGAVGAVYGTYEAIRYKVPGLLKIRHIGQTTLGSAAIFGLFLGAGSLIHCGKSY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo