Report for Sequence Feature Glyma18g14560
Feature Type: gene_model
Chromosome: Gm18
Start: 14437814
stop: 14438648
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g14560
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G23535 AT
Annotation by Michelle Graham. TAIR10: KOW domain-containing protein | chr5:7935871-7937127 FORWARD LENGTH=159
SoyBase E_val: 4.00E-67 ISS
GO:0006412 GO-bp
Annotation by Michelle Graham. GO Biological Process: translation
SoyBase N/A ISS
GO:0005622 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: intracellular
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0005840 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: ribosome
SoyBase N/A ISS
GO:0015934 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit
SoyBase N/A ISS
GO:0003735 GO-mf
Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome
SoyBase N/A ISS
PTHR12903 Panther
MITOCHONDRIAL RIBOSOMAL PROTEIN L24
JGI ISS
PF00467 PFAM
KOW motif
JGI ISS
UniRef100_B9T402 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial ribosomal protein L24, putative n=1 Tax=Ricinus communis RepID=B9T402_RICCO
SoyBase E_val: 1.00E-66 ISS
UniRef100_I1N127 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N127_SOYBN
SoyBase E_val: 2.00E-83 ISS
Expression Patterns of Glyma18g14560
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma18g14560 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g116100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g14560
Coding sequences of Glyma18g14560
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g14560.1 sequence type=CDS gene model=Glyma18g14560 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGGTTGGAAAGCAGCTGAGAAACTCATTAGGCACTGGAAAATTCTCAGAGGGGATAATGTTATGATAACAAGGGACATAGATAAGGGTGAAACTGGGATTATAAAGCGTGTCATTCGCTCTCAAAATTATGTCATTGTAAAAAAGCATATCAAGCAAGGGAAAGGTCATGAAGGGGGCATCTTTACAGTGGAAGCCCCACTGCATGCCTCCAATGTGCAAGTTCTTGACCCAGTGATAGGGTATCCTTGCAAGGTTGGAGTTAAATATCTTGAAGATGGTACTAAAGTTAGAGTGTCTAGAGGAATAGGAGAATTAGGGTCCATAGTCCCTCGTCCCAAGATCCTAAAGATAAGAACTATCTCAAGACCTACAATCTGTAAGTATCTAACAAGCTTATGTTTTTTTCTTGTATGA
Predicted protein sequences of Glyma18g14560
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g14560.1 sequence type=predicted peptide gene model=Glyma18g14560 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MGWKAAEKLIRHWKILRGDNVMITRDIDKGETGIIKRVIRSQNYVIVKKHIKQGKGHEGGIFTVEAPLHASNVQVLDPVIGYPCKVGVKYLEDGTKVRVSRGIGELGSIVPRPKILKIRTISRPTICKYLTSLCFFLV*