SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g14501

Feature Type:gene_model
Chromosome:Gm18
Start:14338402
stop:14339718
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g14501
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G24330AT Annotation by Michelle Graham. TAIR10: ARABIDOPSIS TRITHORAX-RELATED PROTEIN 6 | chr5:8295245-8296997 REVERSE LENGTH=349 SoyBaseE_val: 1.00E-34ISS
GO:0000087GO-bp Annotation by Michelle Graham. GO Biological Process: M phase of mitotic cell cycle SoyBaseN/AISS
GO:0000280GO-bp Annotation by Michelle Graham. GO Biological Process: nuclear division SoyBaseN/AISS
GO:0000911GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation SoyBaseN/AISS
GO:0006261GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication SoyBaseN/AISS
GO:0006275GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009901GO-bp Annotation by Michelle Graham. GO Biological Process: anther dehiscence SoyBaseN/AISS
GO:0010389GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of G2/M transition of mitotic cell cycle SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0051225GO-bp Annotation by Michelle Graham. GO Biological Process: spindle assembly SoyBaseN/AISS
GO:0051322GO-bp Annotation by Michelle Graham. GO Biological Process: anaphase SoyBaseN/AISS
GO:0051726GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle SoyBaseN/AISS
GO:0070734GO-bp Annotation by Michelle Graham. GO Biological Process: histone H3-K27 methylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0046976GO-mf Annotation by Michelle Graham. GO Molecular Function: histone methyltransferase activity (H3-K27 specific) SoyBaseN/AISS
PTHR10615Panther MYST-RELATED PROTEINS JGI ISS
PTHR10615:SF20Panther MYST-RELATED JGI ISS
PF00628PFAM PHD-finger JGI ISS
UniRef100_B9RZJ4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Histone-lysine N-methyltransferase ATXR6, putative n=1 Tax=Ricinus communis RepID=B9RZJ4_RICCO SoyBaseE_val: 1.00E-39ISS
UniRef100_I1JDT0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JDT0_SOYBN SoyBaseE_val: 2.00E-75ISS

Expression Patterns of Glyma18g14501
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g14501 not represented in the dataset
Glyma18g14501 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g14501 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g115400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g14501
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g14501
>Glyma18g14501.1   sequence type=CDS   gene model=Glyma18g14501   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTTCACTTGGTCGAAAAAGAACCCACGCTCCCAAAGGATCCTCCGCCCTTAACGACGACGTTTCCTGCGAGGTATGCAGCGGTGGCCACTCCCCTTCCAAGCTTATTCTCTGCGACAAATGCGACCGTGGTTACCACCTCTTCTGCCTCCGTCCAATTCTTCCCTATGTCCCCAAAGGCTCTTGGTTCTGCCCCTCTTGCTCCAATCACAAACCCAAGTCTTTCCCCCTTGTCCAGACCAAAATCATCGACTTCTTTCGAATCCAACGCTCCCCCGAGGCATTATCAAATCAAGACACGCGGAGGAAGCGAAAGCAGGGTGGGGGCTTGGTGGTAACGAAGAAGAAGGGGAAGCTGGCGTCTTTAGTTTTTTTTTTTTTCAATAATTTTTAA
Predicted protein sequences of Glyma18g14501
>Glyma18g14501.1   sequence type=predicted peptide   gene model=Glyma18g14501   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSLGRKRTHAPKGSSALNDDVSCEVCSGGHSPSKLILCDKCDRGYHLFCLRPILPYVPKGSWFCPSCSNHKPKSFPLVQTKIIDFFRIQRSPEALSNQDTRRKRKQGGGLVVTKKKGKLASLVFFFFNNF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo