SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g14443

Feature Type:gene_model
Chromosome:Gm18
Start:14250148
stop:14250891
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g14443
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G44100AT Annotation by Michelle Graham. TAIR10: guanosine nucleotide diphosphate dissociation inhibitor 1 | chr2:18241804-18244864 FORWARD LENGTH=445 SoyBaseE_val: 3.00E-60ISS
GO:0006487GO-bp Annotation by Michelle Graham. GO Biological Process: protein N-linked glycosylation SoyBaseN/AISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0015031GO-bp Annotation by Michelle Graham. GO Biological Process: protein transport SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0048227GO-bp Annotation by Michelle Graham. GO Biological Process: plasma membrane to endosome transport SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005093GO-mf Annotation by Michelle Graham. GO Molecular Function: RAB GDP-dissociation inhibitor activity SoyBaseN/AISS
PTHR11787Panther RAB GDP-DISSOCIATION INHIBITOR JGI ISS
PF00996PFAM GDP dissociation inhibitor JGI ISS
UniRef100_I1KSQ3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KSQ3_SOYBN SoyBaseE_val: 3.00E-70ISS
UniRef100_O65744UniRef Annotation by Michelle Graham. Most informative UniRef hit: GDP dissociation inhibitor n=1 Tax=Cicer arietinum RepID=O65744_CICAR SoyBaseE_val: 2.00E-65ISS

Expression Patterns of Glyma18g14443
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g14443 not represented in the dataset
Glyma18g14443 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g14443 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g115100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g14443
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g14443
>Glyma18g14443.1   sequence type=CDS   gene model=Glyma18g14443   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGAGGAGTACGATGTGATTGTGTTGGGCATGGGTCTCAAGGAGTGCATTCTTAGCAGTCTTCTCTCCGTCGATGGCCTCAAGGTTCTGGACATGGACATGAATGACTATTACGGAGGAGAATCCACTTCGCTCAATCTTATTCAGCTTTGGAAGAGATTCAAGGGAGATGACAAGCCTCCTCCACATTTGGGTGCTAGCAGGGACTATAACATCGATATGAACCCTAAGTTTATTATGGCTAATGGCAATTTGGTGCAGGTTCTCATACATACCGATGTTACTAAGTATCTCTCTTTCAAAGTTATGGATGGGAGCTTTGTGTTTAATAAAGGAAAGGTATGTTTATGTGTTGGTGTTACTCATTTATCTTAA
Predicted protein sequences of Glyma18g14443
>Glyma18g14443.1   sequence type=predicted peptide   gene model=Glyma18g14443   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDEEYDVIVLGMGLKECILSSLLSVDGLKVLDMDMNDYYGGESTSLNLIQLWKRFKGDDKPPPHLGASRDYNIDMNPKFIMANGNLVQVLIHTDVTKYLSFKVMDGSFVFNKGKVCLCVGVTHLS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo