SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g14426

Feature Type:gene_model
Chromosome:Gm18
Start:14241964
stop:14249973
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g14426
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G15790AT Annotation by Michelle Graham. TAIR10: peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase | chr2:6878144-6880743 REVERSE LENGTH=361 SoyBaseE_val: 7.00E-37ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0010050GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative phase change SoyBaseN/AISS
GO:0010582GO-bp Annotation by Michelle Graham. GO Biological Process: floral meristem determinacy SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003755GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidyl-prolyl cis-trans isomerase activity SoyBaseN/AISS
PTHR11071Panther CYCLOPHILIN JGI ISS
PTHR11071:SF98Panther JGI ISS
PF07719PFAM Tetratricopeptide repeat JGI ISS
UniRef100_B9S777UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peptidyl-prolyl cis-trans isomerase d, ppid, putative n=1 Tax=Ricinus communis RepID=B9S777_RICCO SoyBaseE_val: 1.00E-45ISS
UniRef100_I1KLX5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KLX5_SOYBN SoyBaseE_val: 9.00E-57ISS

Expression Patterns of Glyma18g14426
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g14426 not represented in the dataset
Glyma18g14426 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g14426 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g115000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g14426
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g14426
>Glyma18g14426.1   sequence type=CDS   gene model=Glyma18g14426   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTATATTATGCCTTTGCAGAGATAAGTTCAAGTTTGAGAAAAACGAAGTCCCAGAGTTTTACAAACAACTCTGCTTCTAAATTGAAATTAAGGGATGTTAAAGGAGCATTACTGGATACAGAATTTGCAATGTGTGAGGGAGATGACAATGCTAAAGCTTTGTTCCACCAAGGACAGGCATACATGGCACTCCATGACATTCATGTTGCAGTTGAAAGCTTTAAGAAGGCACTGACCATGGAGCCAAATGATGCTGGAATAAAAAAGGAACTTGCTGCAGCTAGGAAGATGATAGCTGATAGGCGTGATCAAGAGAAAAAAGCATATCAAGAGAAAAAAGCATATAGCAAGATGTTCCAATAA
Predicted protein sequences of Glyma18g14426
>Glyma18g14426.1   sequence type=predicted peptide   gene model=Glyma18g14426   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVYYAFAEISSSLRKTKSQSFTNNSASKLKLRDVKGALLDTEFAMCEGDDNAKALFHQGQAYMALHDIHVAVESFKKALTMEPNDAGIKKELAAARKMIADRRDQEKKAYQEKKAYSKMFQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo