Glyma18g14150 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g14150): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g14150): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g14150

Feature Type:	gene_model
Chromosome:	Gm18
Start:	13658188
stop:	13661150
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g14150

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G03760	AT	Annotation by Michelle Graham. TAIR10: Nucleotide-diphospho-sugar transferases superfamily protein \| chr5:985910-990087 REVERSE LENGTH=533	SoyBase	E_val: 1.00E-14	ISS
GO:0006816	GO-bp	Annotation by Michelle Graham. GO Biological Process: calcium ion transport	SoyBase	N/A	ISS
GO:0007030	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi organization	SoyBase	N/A	ISS
GO:0009294	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA mediated transformation	SoyBase	N/A	ISS
GO:0009617	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to bacterium	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009736	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway	SoyBase	N/A	ISS
GO:0042546	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall biogenesis	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
GO:0051753	GO-mf	Annotation by Michelle Graham. GO Molecular Function: mannan synthase activity	SoyBase	N/A	ISS
PTHR10587	Panther	N-ACETYLGLUCOSAMINYLTRANSFERASE-RELATED	JGI		ISS
PTHR10587:SF34	Panther	MANNAN SYNTHASE	JGI		ISS
UniRef100_I1NHP1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1NHP1_SOYBN	SoyBase	E_val: 2.00E-12	ISS
UniRef100_Q9LZR3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Glucomannan 4-beta-mannosyltransferase 9 n=1 Tax=Arabidopsis thaliana RepID=CSLA9_ARATH	SoyBase	E_val: 5.00E-12	ISS

Expression Patterns of Glyma18g14150

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g14150 not represented in the dataset	Glyma18g14150 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g14150 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g114000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g14150

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g14150

Limit To All Plant Sequences

>Glyma18g14150.1   sequence type=CDS   gene model=Glyma18g14150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAGTCCAATCAGATATATGTAGACTGTAGAGCAATGGTGAAGTTACTAATCATTAAATGTGTTAGACTTTATACATTACTGGCACCAATGGTTCTGTATCAGGGCAGAGTAACCCTGGATACCCTATCACCACAGTCGAGACAAGGCAGCTTTAGCTGTGGCTCAAAAGTAGTGTCAAGAGATGCAGTGGGGTCTTCCACTTACCCGTTCTTTGATTTCAACATATGGAGAATTTTGGCGTTGAATGAGGCTGGTGGATGGAAGGATAGGACCACACTGGAAGATATGAACTTGGTGGTGCGAGCCAATGCCTATGTGGATTCATTGTATATAATATATGATAAATTCGAATACTTAATTAGAATGAAGTTGACAAGCACTGAATGTTGTTACTGCCAAACCATAAGCCATAACAAGCATGACAAGAGCCAACACTTTCTTTTCTCCCATCTCACCTTGAATATCTATACTACTTTATTTTTGGTATTATGA

Predicted protein sequences of Glyma18g14150

Limit To All Plant Sequences

>Glyma18g14150.1   sequence type=predicted peptide   gene model=Glyma18g14150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KSNQIYVDCRAMVKLLIIKCVRLYTLLAPMVLYQGRVTLDTLSPQSRQGSFSCGSKVVSRDAVGSSTYPFFDFNIWRILALNEAGGWKDRTTLEDMNLVVRANAYVDSLYIIYDKFEYLIRMKLTSTECCYCQTISHNKHDKSQHFLFSHLTLNIYTTLFLVL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain