SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g14103): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g14103): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g14103

Feature Type:gene_model
Chromosome:Gm18
Start:13644113
stop:13647177
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G73050AT Annotation by Michelle Graham. TAIR10: Glucose-methanol-choline (GMC) oxidoreductase family protein | chr1:27476565-27478534 REVERSE LENGTH=552 SoyBaseE_val: 5.00E-38ISS
GO:0006066GO-bp Annotation by Michelle Graham. GO Biological Process: alcohol metabolic process SoyBaseN/AISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0046202GO-bp Annotation by Michelle Graham. GO Biological Process: cyanide biosynthetic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0008812GO-mf Annotation by Michelle Graham. GO Molecular Function: choline dehydrogenase activity SoyBaseN/AISS
GO:0016614GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on CH-OH group of donors SoyBaseN/AISS
GO:0050660GO-mf Annotation by Michelle Graham. GO Molecular Function: flavin adenine dinucleotide binding SoyBaseN/AISS
PTHR11552Panther GLUCOSE-METHANOL-CHOLINE (GMC) OXIDOREDUCTASE JGI ISS
PTHR11552:SF31Panther gb def: fldc protein [sphingomonas sp. lb126] JGI ISS
PF05199PFAM GMC oxidoreductase JGI ISS
UniRef100_G7JVJ8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mandelonitrile lyase n=1 Tax=Medicago truncatula RepID=G7JVJ8_MEDTR SoyBaseE_val: 1.00E-44ISS
UniRef100_I1KG46UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KG46_SOYBN SoyBaseE_val: 2.00E-57ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g14103 not represented in the dataset

Glyma18g14103 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g113700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g14103.1   sequence type=CDS   gene model=Glyma18g14103   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGGTCGCCGCAAGCAAGGACGCAACCTAGGGTTTCAGTGGCGGAGAAGCATAGGGACACTGCTTTCGTCCTCCGCTCCCTGCTCTATGTCACTATGGCGACCCTCATTTCCAGGGTTTCGGGGCCACTCTCCAATGGGTTTCTAAGGTTGGCCTTGATGGACGTGATTGTGAATCCCGTGGTGAGATTCAATTACTTCAACAACCTCGTTGACATGGAGCGATGCATGAATGGGACGAGGAAGATAGTGGAGATCTTGGGGAGCAGGGCTTTGAGGGATTTCAAGTTTAGCAACTGGTTCGGGGAGCGAGACTTTAGGTTCATTGGCCTTGCTTTGCCACTTCACCAGACCGACTTCCCTAGTATGTCGTATTTCTATTGCTGGACAGTGAGCTCCATATGGCACTACCATGGAGGCTGCCACTATGATGAGCATTTTTACTTCAGGGTCGAGGATGGAGAGGACGACAGTAGCGATGCCAGGGTCAAAACAATTTGA

>Glyma18g14103.1   sequence type=predicted peptide   gene model=Glyma18g14103   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MWSPQARTQPRVSVAEKHRDTAFVLRSLLYVTMATLISRVSGPLSNGFLRLALMDVIVNPVVRFNYFNNLVDMERCMNGTRKIVEILGSRALRDFKFSNWFGERDFRFIGLALPLHQTDFPSMSYFYCWTVSSIWHYHGGCHYDEHFYFRVEDGEDDSSDARVKTI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo