SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g13700

Feature Type:gene_model
Chromosome:Gm18
Start:13280302
stop:13283892
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G17230AT Annotation by Michelle Graham. TAIR10: PHYTOENE SYNTHASE | chr5:5659839-5662087 REVERSE LENGTH=422 SoyBaseE_val: 0ISS
GO:0006636GO-bp Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process SoyBaseN/AISS
GO:0006655GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process SoyBaseN/AISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0010287GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule SoyBaseN/AISS
GO:0016740GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity SoyBaseN/AISS
GO:0016765GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring alkyl or aryl (other than methyl) groups SoyBaseN/AISS
GO:0016767GO-mf Annotation by Michelle Graham. GO Molecular Function: geranylgeranyl-diphosphate geranylgeranyltransferase activity SoyBaseN/AISS
GO:0046905GO-mf Annotation by Michelle Graham. GO Molecular Function: phytoene synthase activity SoyBaseN/AISS
KOG1459 KOG Squalene synthetase JGI ISS
PF00494PFAM Squalene/phytoene synthase JGI ISS
UniRef100_C5I849UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phytoene synthase protein n=1 Tax=Fragaria x ananassa RepID=C5I849_FRAAN SoyBaseE_val: 0ISS
UniRef100_C6T9N7UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T9N7_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g41890 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g111900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g13700.1   sequence type=CDS   gene model=Glyma18g13700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGGTGTTCTTCTTTGGGTGAGTTGTGGACCCAAGGAGAACCCCATCTCCATTGTTGGTCTTGCTGGAAGAGGTGGCAGAAGCCAGAGGAGGTTTGGACTGTGCAATGGGATCAGTTTTGCAAGCTTTTCACCAGCAGTGGCAGACCCTTCAAGATCCTCAGAGGAGAGGGTATATGAGGTGGTGTTGAAGCAAGCAGCACTGGTCAAGGAGAAGAATAAGGGCACCAAGAGAGCACTGAATTTAGACAAACCAACAGTTGAAGGTGATTTAACCCATGGGGATCTGTTGAGTGCTGCTTATGATAGGTGTGGTGAAGTCTGTGCTGAATATGCCAAGACATTTTATCTTGGCACACAATTGATGACCCAAGAGCGCAGAAAAGCCATCTGGGCCATATACGTGTGGTGCAGAAGAACCGATGAACTAGTGGATGGACCTAATGCTTCTCACATCACACCAAAGGCCTTGGACAGGTGGGAGCAAAGACTATACGATGTTTTTGAAGGCCGGCCTTATGATATGTATGATGCTGCCCTCTCAGATACAGTTTCAAAGTACCCAGTTGATATACAGCCATTTAAGGACATGATTGAAGGGATGAGGCTGGATCTGAGAAAGTCAAGATACAATAACTTTGATGAACTCTACCTTTACTGCTACTATGTAGCTGGGACAGTGGGACTCATGAGTGTTCCAGTAATGGGGATAGCACCAGAATCAAAGGCTTCGACAGAGAGTGTCTATAATGCTGCATTGGCACTTGGCATTGCTAATCAACTTACCAACATTCTCAGAGACGTTGGAGAAGATGCAAGAAGAGGAAGAGTATATCTTCCACAAGATGAATTGGCACAAGCTGGCCTATCAGATGATGACATTTTTAGAGGGAAAGTTACCGACAAGTGGCGCAATTTCATGAAGGGCCAAATACAGAGAGCAAGGATGTTTTTTGATGAGGCAGAGAAGGGAGTTTCAGAGCTCAACTCTGCAAGCAGGTGGCCAGTATGGGCATCTTTGTTGTTGTATAGGCAAATCTTAGATTCTATTGAAGCCAATGACTACAATAACTTCACTAAAAGAGCTTATGTAGGTAAAGTTAAGAAGCTGCTATCACTACCTGCTGCATATGGAAGAGCACTTCTAGGTCCCCAAAAGTTGACCAAAATGGTTACGAGAAGTATGTAA

>Glyma18g13700.1   sequence type=predicted peptide   gene model=Glyma18g13700   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGVLLWVSCGPKENPISIVGLAGRGGRSQRRFGLCNGISFASFSPAVADPSRSSEERVYEVVLKQAALVKEKNKGTKRALNLDKPTVEGDLTHGDLLSAAYDRCGEVCAEYAKTFYLGTQLMTQERRKAIWAIYVWCRRTDELVDGPNASHITPKALDRWEQRLYDVFEGRPYDMYDAALSDTVSKYPVDIQPFKDMIEGMRLDLRKSRYNNFDELYLYCYYVAGTVGLMSVPVMGIAPESKASTESVYNAALALGIANQLTNILRDVGEDARRGRVYLPQDELAQAGLSDDDIFRGKVTDKWRNFMKGQIQRARMFFDEAEKGVSELNSASRWPVWASLLLYRQILDSIEANDYNNFTKRAYVGKVKKLLSLPAAYGRALLGPQKLTKMVTRSM*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo