SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g13640): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g13640): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g13640

Feature Type:gene_model
Chromosome:Gm18
Start:13164051
stop:13165364
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G30860AT Annotation by Michelle Graham. TAIR10: glutathione S-transferase PHI 9 | chr2:13139132-13140057 FORWARD LENGTH=215 SoyBaseE_val: 5.00E-74ISS
GO:0006546GO-bp Annotation by Michelle Graham. GO Biological Process: glycine catabolic process SoyBaseN/AISS
GO:0006569GO-bp Annotation by Michelle Graham. GO Biological Process: tryptophan catabolic process SoyBaseN/AISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009684GO-bp Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process SoyBaseN/AISS
GO:0010043GO-bp Annotation by Michelle Graham. GO Biological Process: response to zinc ion SoyBaseN/AISS
GO:0031347GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0004364GO-mf Annotation by Michelle Graham. GO Molecular Function: glutathione transferase activity SoyBaseN/AISS
GO:0004602GO-mf Annotation by Michelle Graham. GO Molecular Function: glutathione peroxidase activity SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0043295GO-mf Annotation by Michelle Graham. GO Molecular Function: glutathione binding SoyBaseN/AISS
KOG0867 KOG Glutathione S-transferase JGI ISS
PTHR11260Panther GLUTATHIONE S-TRANSFERASE, GST, SUPERFAMILY, GST DOMAIN CONTAINING JGI ISS
PTHR11260:SF55Panther SUBFAMILY NOT NAMED JGI ISS
PF00043PFAM Glutathione S-transferase, C-terminal domain JGI ISS
PF02798PFAM Glutathione S-transferase, N-terminal domain JGI ISS
UniRef100_Q06FE1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glutathione S-transferase (Fragment) n=1 Tax=Pyrus communis RepID=Q06FE1_PYRCO SoyBaseE_val: 2.00E-90ISS
UniRef100_UPI000233E566UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E566 related cluster n=1 Tax=unknown RepID=UPI000233E566 SoyBaseE_val: 8.00E-121ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g13640 not represented in the dataset

Glyma18g13640 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g111300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g13640.2   sequence type=CDS   gene model=Glyma18g13640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGGTGAAGGTGTACGGTCCAACCTATGCATCCCCCAAGAGAGTGCTGGTGTGTCTGATTGAGAAGGAGATTGAGTTTGAAACAGTGCATGTTGATCTCTTCAAGGGAGAGGCTAAGGAACCTGAGTTCCTTAAGCTGCAGCCATTTGGATTGCTTCCTGTTATTCAAGATGGAGATTATACTCTCTATGAATCTCGTGCAATAATAAGATACTATGCAGAGAAGTATAAAGACCAAGGCACAGACTTGTTGGGAAAGACAATAGAGGAAAGGGACCCAAAAGTGATAGAAGAGAGTGATAAAAAGATTGAGAAGGTGCTGGATGTTTATGAGGAGAGGCTGTCAAAGAGCAAGTACTTGGCTGGTGATTTCTTCTGCCTTGCTGATCTTAGCCACCTACCAGCTGGTCATTATTTGGTGAACCAAACTGGGAGAGGGAATTTGGTTAGAGAGAGGAAGCATGTGAGTGCTTGGTGGGATGATATTAGTAATAGACCATCTTGGCATAAGGTTCTTCAGCTATATAAATACCCTGTCTAG

>Glyma18g13640.2   sequence type=predicted peptide   gene model=Glyma18g13640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVVKVYGPTYASPKRVLVCLIEKEIEFETVHVDLFKGEAKEPEFLKLQPFGLLPVIQDGDYTLYESRAIIRYYAEKYKDQGTDLLGKTIEERDPKVIEESDKKIEKVLDVYEERLSKSKYLAGDFFCLADLSHLPAGHYLVNQTGRGNLVRERKHVSAWWDDISNRPSWHKVLQLYKYPV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo