SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g13077): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g13077): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g13077

Feature Type:gene_model
Chromosome:Gm18
Start:12516456
stop:12526090
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g13077
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G17310AT Annotation by Michelle Graham. TAIR10: unknown protein; LOCATED IN: chloroplast; EXPRESSED IN: 9 plant structures; EXPRESSED DURING: LP.04 four leaves visible, 4 anthesis, petal differentiation and expansion stage; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G47455.3); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr4:9685429-9686848 REVERSE LENGTH=97 SoyBaseE_val: 2.00E-14ISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
UniRef100_I1N0Y6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N0Y6_SOYBN SoyBaseE_val: 3.00E-44ISS

Expression Patterns of Glyma18g13077
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g13077 not represented in the dataset
Glyma18g13077 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g13077 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g109000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g13077
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g13077
>Glyma18g13077.1   sequence type=CDS   gene model=Glyma18g13077   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTTCGCATGCAGCAGAATCGCGCAACGAACATCAATTTCATCTATAAAATCAGCCATCAAATCCAACATTCGCGCTTCTTCATTCTCCAAACCAGCTTCCTCCTTTTCTCCTATTTGCCAATCCTTATTGGCCAGGATTTTGCAGGAGCTGAGATGCGTGCAGTCGATGTTGCCGCTGCACAGCACGGTGGCGGCGGCGAGAATGATGTCGTGTCTGACTTTCAAAAGTTGTCGAGCGCTTTCACCGGAGTTCTTTAAAAAGGAGCCTAGGTGGACTATGTGTGCAATTCTCAGCCCAACTTTTAAAGTACGGGAGTTTCAGTGTATGAGAATGATGGGTCTTGAGTGGAAGGATATTGCTTTTGTTCAGAAGTCAAATTTGGAGAGTTATATACAATGA
Predicted protein sequences of Glyma18g13077
>Glyma18g13077.1   sequence type=predicted peptide   gene model=Glyma18g13077   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAFACSRIAQRTSISSIKSAIKSNIRASSFSKPASSFSPICQSLLARILQELRCVQSMLPLHSTVAAARMMSCLTFKSCRALSPEFFKKEPRWTMCAILSPTFKVREFQCMRMMGLEWKDIAFVQKSNLESYIQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo