Glyma18g13001 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g13001

Feature Type:	gene_model
Chromosome:	Gm18
Start:	12399542
stop:	12400081
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g13001

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
PF05678	PFAM	VQ motif	JGI		ISS
UniRef100_G7IXH6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=G7IXH6_MEDTR	SoyBase	E_val: 8.00E-55	ISS

Proteins Associated with Glyma18g13001

Locus	Gene Symbol	Protein Name
	VQ68	VQ motif containing protein gene 68

Expression Patterns of Glyma18g13001

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g13001 not represented in the dataset	Glyma18g13001 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g13001

Paralog	Evidence	Comments
Glyma08g42125	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g13001 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g108600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g13001

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g13001

Limit To All Plant Sequences

>Glyma18g13001.1   sequence type=CDS   gene model=Glyma18g13001   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAGGAAAGTAAGTCAAGGATCACTGAAAATATCTAAGGTTGATCATCAGAAACATCAATTCAACACTCTGATCAAGATCTTACGGCCTAAGGTCTACATCACTGACAGCTCAAGCTTCAAGAAGTTAGTTCAAGAGCTAACTGGCAATGGAAGCCCCACCACTTTGTCTCCACCACCTTTGGAACCAAACATGGATGAAAATTTCCCCCTTATTGGAACTGAGGCTCAGAGTGACCCTCAAACTAGTCCTGATGATGTTTCAATCTCCCCTGAAGTAACTAGCAACTCACCTGAGTTGTGCTATGATGCATTGATGAATGAAGAGTTTAACCAAGTTTGCAACCAGTTATGCTTAGATGGCCTAGCCTTCCAACAAGACTCAGTGACCAACCAATCTATTGACCATTTTTTGGCATATCAGAATCTTGAGTCACTACTGCTTGATGTTGAACCAAATCCCTTGTACAGCTGTTATGAACAGATGGTGCAGCCAGATGTCAGCATATATGATTATGAGTTGTCAGGAATACTATGA

Predicted protein sequences of Glyma18g13001

Limit To All Plant Sequences

>Glyma18g13001.1   sequence type=predicted peptide   gene model=Glyma18g13001   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRKVSQGSLKISKVDHQKHQFNTLIKILRPKVYITDSSSFKKLVQELTGNGSPTTLSPPPLEPNMDENFPLIGTEAQSDPQTSPDDVSISPEVTSNSPELCYDALMNEEFNQVCNQLCLDGLAFQQDSVTNQSIDHFLAYQNLESLLLDVEPNPLYSCYEQMVQPDVSIYDYELSGIL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain