Glyma18g12540 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g12540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g12540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g12540

Feature Type:	gene_model
Chromosome:	Gm18
Start:	11679487
stop:	11685093
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g12540

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G46160	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein L14p/L23e family protein \| chr5:18711456-18712341 REVERSE LENGTH=172	SoyBase	E_val: 8.00E-72	ISS
GO:0000394	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation	SoyBase	N/A	ISS
GO:0006354	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation	SoyBase	N/A	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0009086	GO-bp	Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0015934	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG0901	KOG	60S ribosomal protein L14/L17/L23	JGI		ISS
PTHR11761	Panther	50S RIBOSOMAL PROTEIN L14-RELATED	JGI		ISS
PTHR11761:SF3	Panther	UNCHARACTERIZED	JGI		ISS
PF00238	PFAM	Ribosomal protein L14p/L23e	JGI		ISS
UniRef100_G7K4R8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 50S ribosomal protein L14 n=1 Tax=Medicago truncatula RepID=G7K4R8_MEDTR	SoyBase	E_val: 7.00E-84	ISS
UniRef100_I1KY31	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KY31_SOYBN	SoyBase	E_val: 1.00E-84	ISS

Expression Patterns of Glyma18g12540

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g12540 not represented in the dataset	Glyma18g12540 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g12540

Paralog	Evidence	Comments
Glyma08g42330	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g12540 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g105500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g12540

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g12540

Limit To All Plant Sequences

>Glyma18g12540.2   sequence type=CDS   gene model=Glyma18g12540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATAATTACTTGAAAAATTGGAGTTGGGTATGGGATGAGGATATACTCACAACTTTACGTGATATAGGTGCAGTGGGCCGTTCTCTGTCTGGTGGATTAAGCAACAGTTCCCCTGGTTTATTTACCTCATCACATGGCATGACATGCAACAATTTGTTTTCTCAGCAACAACGTACCTTCATACAGATGAGGACTGTTCTCAAGGTTGTCGATAACTCAGGTGCTAAAAAGGCATTGAAAGGGAAGAAAGGGGCAAGATTAGGTGACACAATAATAGCATCTGTGAAGGAAGCACATCCTAATGGAAAAGTGAAGAAAGGGAAGGTTGTATATGGGGTAGTTGTGCGTGCAGCAATGCAAAAGGGACGTTGTGATGGCAGTGAGGTCAAGTTTGATGATAATGCTGTGGTGCTTGTTGACAAGCAAGGACAACCTATTGGAACCAGAGTTTTTGGACCAGTGCCTCATGAGCTAAGGCAAAAGAAGCATGTCAAGATTCTTACCTTGGCAGGGCACATTGCATAA

Predicted protein sequences of Glyma18g12540

Limit To All Plant Sequences

>Glyma18g12540.2   sequence type=predicted peptide   gene model=Glyma18g12540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDNYLKNWSWVWDEDILTTLRDIGAVGRSLSGGLSNSSPGLFTSSHGMTCNNLFSQQQRTFIQMRTVLKVVDNSGAKKALKGKKGARLGDTIIASVKEAHPNGKVKKGKVVYGVVVRAAMQKGRCDGSEVKFDDNAVVLVDKQGQPIGTRVFGPVPHELRQKKHVKILTLAGHIA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain