Glyma18g12240 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g12240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g12240): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g12240

Feature Type:	gene_model
Chromosome:	Gm18
Start:	11283269
stop:	11285701
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g12240

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G12490	AT	Annotation by Michelle Graham. TAIR10: cystatin B \| chr3:3960523-3961777 REVERSE LENGTH=201	SoyBase	E_val: 4.00E-37	ISS
GO:0006972	GO-bp	Annotation by Michelle Graham. GO Biological Process: hyperosmotic response	SoyBase	N/A	ISS
GO:0006979	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to oxidative stress	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0004869	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cysteine-type endopeptidase inhibitor activity	SoyBase	N/A	ISS
GO:0050897	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cobalt ion binding	SoyBase	N/A	ISS
PTHR11413	Panther	CYSTATIN FAMILY MEMBER	JGI		ISS
PTHR11413:SF3	Panther	CYSTATIN PRECURSOR	JGI		ISS
PF00031	PFAM	Cystatin domain	JGI		ISS
UniRef100_C0STW6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cystatin n=1 Tax=Spinacia oleracea RepID=C0STW6_SPIOL	SoyBase	E_val: 8.00E-42	ISS
UniRef100_UPI000233E2AB	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E2AB related cluster n=1 Tax=unknown RepID=UPI000233E2AB	SoyBase	E_val: 2.00E-66	ISS

Expression Patterns of Glyma18g12240

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g12240 not represented in the dataset	Glyma18g12240 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g12240 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g103700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g12240

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma18g12240

Limit To All Plant Sequences

>Glyma18g12240.2   sequence type=transcript   gene model=Glyma18g12240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AATTTGACCAAGATATATACAATTTTATAGATTAGTCTAAAGTCTAAAGGGAGCCTTGATCTCTCTCTCTCTCTATATATTACTAAAAACATCGATCACTATCTCGTAACATATATTCAAGAAAGAGACTGAGAGGAAGAGAATGGCAATGATAGGAGGCATTAGCCAAGTGGAGGGAAGCCAAAACAGTGCTACCATCGATAGGCTCGCTCATTTTGCTGTTGATGAGCATAATAAGAAAGAGAATGCAGTTCTGGAATTTGTGAAGGTGGTAAATGTGAAACAGCAAGTGGTTTCTGGAATGCTGTACTATATCACTCTAGAGGCCAAGGATGGAGAGAAGAATAAAGTTTATGAGACCAAGGTTTGGGTGAAGCCATGGTTGGACTTCAAGGAGATACAGGAATTCAAGCTCATCGGTGATGCCCCTTATGCTGCACCCATTCTTGTTCACAGGCTAACTACTAAAGACAACAGAGAAGCATATTTACCGGTGATCTTTTGATTCGTGTTGTAAAGGTGTATAATATCAGTTCGTGCTGAATGTTTGGGAAGATGTAATTCATGTGTAAAATGAAGCTCAATAATGCAGTCAATATTTGTCGTCATGTATATCAATTTTTTTCTTATATTTTTTTTGCACGAAATTTTAGATTTAAAGTTATTATGTGTTCATTATGTTTCACAATTATTTTGTTTTGATGTGTTAAGTTCAAAGTTTCATTTTAATCTTTTATATTTTTGAAATGTATCATTTTGATTTTTTT

Coding sequences of Glyma18g12240

Limit To All Plant Sequences

>Glyma18g12240.1   sequence type=CDS   gene model=Glyma18g12240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAATGATAGGAGGCATTAGCCAAGTGGAGGGAAGCCAAAACAGTGCTACCATCGATAGGCTCGCTCATTTTGCTGTTGATGAGCATAATAAGAAAGAGAATGCAGTTCTGGAATTTGTGAAGGTGGTAAATGTGAAACAGCAAGTGGTTTCTGGAATGCTGTACTATATCACTCTAGAGGCCAAGGATGGAGAGAAGAATAAAGTTTATGAGACCAAGGTTTGGGTGAAGCCATGGTTGGACTTCAAGGAGATACAGGAATTCAAGCTCATCGGTGATGCCCCTTATGCTGCACCCAGCTAA

>Glyma18g12240.2   sequence type=CDS   gene model=Glyma18g12240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAATGATAGGAGGCATTAGCCAAGTGGAGGGAAGCCAAAACAGTGCTACCATCGATAGGCTCGCTCATTTTGCTGTTGATGAGCATAATAAGAAAGAGAATGCAGTTCTGGAATTTGTGAAGGTGGTAAATGTGAAACAGCAAGTGGTTTCTGGAATGCTGTACTATATCACTCTAGAGGCCAAGGATGGAGAGAAGAATAAAGTTTATGAGACCAAGGTTTGGGTGAAGCCATGGTTGGACTTCAAGGAGATACAGGAATTCAAGCTCATCGGTGATGCCCCTTATGCTGCACCCATTCTTGTTCACAGGCTAACTACTAAAGACAACAGAGAAGCATATTTACCGGTGATCTTTTGA

Predicted protein sequences of Glyma18g12240

Limit To All Plant Sequences

>Glyma18g12240.1   sequence type=predicted peptide   gene model=Glyma18g12240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAMIGGISQVEGSQNSATIDRLAHFAVDEHNKKENAVLEFVKVVNVKQQVVSGMLYYITLEAKDGEKNKVYETKVWVKPWLDFKEIQEFKLIGDAPYAAPS*

>Glyma18g12240.2   sequence type=predicted peptide   gene model=Glyma18g12240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAMIGGISQVEGSQNSATIDRLAHFAVDEHNKKENAVLEFVKVVNVKQQVVSGMLYYITLEAKDGEKNKVYETKVWVKPWLDFKEIQEFKLIGDAPYAAPILVHRLTTKDNREAYLPVIF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain