SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g11660

Feature Type:gene_model
Chromosome:Gm18
Start:10433014
stop:10435669
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G54855AT Annotation by Michelle Graham. TAIR10: Pollen Ole e 1 allergen and extensin family protein | chr5:22282902-22284251 FORWARD LENGTH=146 SoyBaseE_val: 2.00E-70ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF01190PFAM Pollen proteins Ole e I like JGI ISS
UniRef100_C6SVQ8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SVQ8_SOYBN SoyBaseE_val: 1.00E-102ISS
UniRef100_Q94EJ3UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT1g27100/T7N9_16 n=2 Tax=Arabidopsis thaliana RepID=Q94EJ3_ARATH SoyBaseE_val: 9.00E-68ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g42630 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g099800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g11660.1   sequence type=CDS   gene model=Glyma18g11660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAAGCAGAAGACACTGATGAGTTTGATTCTGTTGCTGTTGTTATTTACTTCGGATGTGAGTGCTTGGACCGGTGAAATCCATGGAAGAGTTGTTTGTGACGTTTGTGGGGATTCTTCTCTTGGACCTGAAGACCATATTCTTGAAGGTGCTGAGGTTGCTGTTCTTTGCATCACCAAGTCTGGGGAAGTTCTAAATTATCAGGCATTCACTGATGCTAAGGGGATATACACGGTGGCCGAAACAATGCCGGAAAGTGATCGCTGGGATGCGTGTCTTGCCCGACCAATCAGTAGTTTCCACGAGCAATGCACTCAACTTGGTGAAGGCAGCATAGGGGTTAAATTCAGTTACAATCATCCATCAGGACATTCACACACTGTCAGGACCTTTGTATATCGACCCACCAGTGTTCCAACTTACTGCATTTGA

>Glyma18g11660.1   sequence type=predicted peptide   gene model=Glyma18g11660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKQKTLMSLILLLLLFTSDVSAWTGEIHGRVVCDVCGDSSLGPEDHILEGAEVAVLCITKSGEVLNYQAFTDAKGIYTVAETMPESDRWDACLARPISSFHEQCTQLGEGSIGVKFSYNHPSGHSHTVRTFVYRPTSVPTYCI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo