SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g10990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g10990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g10990

Feature Type:gene_model
Chromosome:Gm18
Start:9827709
stop:9831732
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G28490AT Annotation by Michelle Graham. TAIR10: syntaxin of plants 61 | chr1:10016433-10017842 FORWARD LENGTH=245 SoyBaseE_val: 5.00E-121ISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005802GO-cc Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network SoyBaseN/AISS
GO:0030140GO-cc Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network transport vesicle SoyBaseN/AISS
GO:0005484GO-mf Annotation by Michelle Graham. GO Molecular Function: SNAP receptor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG3202 KOG SNARE protein TLG1/Syntaxin 6 JGI ISS
PTHR12380Panther SYNTAXIN JGI ISS
PF05739PFAM SNARE domain JGI ISS
PF09177PFAM Syntaxin 6, N-terminal JGI ISS
UniRef100_G7K3H9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Syntaxin-61 n=1 Tax=Medicago truncatula RepID=G7K3H9_MEDTR SoyBaseE_val: 3.00E-131ISS
UniRef100_I1N0N7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N0N7_SOYBN SoyBaseE_val: 8.00E-180ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g10990 not represented in the dataset

Glyma18g10990 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g42880 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g096200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g10990.1   sequence type=CDS   gene model=Glyma18g10990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCCTCTGCCCAGGATCCATTTTACGTTGTCAAGGCCGAGATTCAAGATTCTATTGATAAGCTGCAATCTACTTTTCACCAATGGGAAAGCAAGTCCGGTGCTGCGGAACAAGGACATCTTACAAAGGAGGTTCTTGCTGGATGCGAAAGCATAGAGTGGCAGGTGGATGAATTGGATAAGGCAATTGCTATAGCATCTAGAGATCCTTCTTGGTATGGGATAGATGAAGCTGAGGTCGAAAGCCGAAGGAGATGGACAAGTAACACTCGTTCTCAGGTTGGCACAATGAAGAAAGCAGTGGAATCTGGCAAGGGCTCAAGTACCACAAGCCATGCTAGTGTTAATGGGATGCGCCGAGAACTAATGAGGCTACCAAATTCTCATCAAACTGATAGCTCTAACCAGTATGCTGCCCGAGATAATGATGATTTCATACTATCAGAATCAGATAGACAAACACTTCTTATAAAGAGACAGGATGAGGAATTGGATGAGCTTAGTGAAAGTGTACGAAGAATCGGAGGTGTTGGACTTACAATACATGATGAACTCACTGCACAGGAAAAGATTCTAGATGAACTTGGTTCCGAGATGGACAGTACAACAAATCGTCTTGATTTTGTCCAAAAAAAAGTGGCGATGGTTATGAAAAAGGCTAGTGCAAAGGGTCAGATCATGATGATATTGGGTTTGTTGGCCCTGTTCATCTTCCTCTTTATCTTAGTATTCTTCACCTAG

>Glyma18g10990.1   sequence type=predicted peptide   gene model=Glyma18g10990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPSAQDPFYVVKAEIQDSIDKLQSTFHQWESKSGAAEQGHLTKEVLAGCESIEWQVDELDKAIAIASRDPSWYGIDEAEVESRRRWTSNTRSQVGTMKKAVESGKGSSTTSHASVNGMRRELMRLPNSHQTDSSNQYAARDNDDFILSESDRQTLLIKRQDEELDELSESVRRIGGVGLTIHDELTAQEKILDELGSEMDSTTNRLDFVQKKVAMVMKKASAKGQIMMILGLLALFIFLFILVFFT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo