Glyma18g09940 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g09940

Feature Type:	gene_model
Chromosome:	Gm18
Start:	8784698
stop:	8786816
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g09940

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G55510	AT	Annotation by Michelle Graham. TAIR10: Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein \| chr5:22486525-22487916 REVERSE LENGTH=214	SoyBase	E_val: 1.00E-54	ISS
GO:0015031	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein transport	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005744	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane presequence translocase complex	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0015450	GO-mf	Annotation by Michelle Graham. GO Molecular Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity	SoyBase	N/A	ISS
KOG3225	KOG	Mitochondrial import inner membrane translocase, subunit TIM22	JGI		ISS
PTHR14110	Panther	TRANSLOCASE OF INNER MITOCHONDRIAL MEMBRANE TIM22	JGI		ISS
PF02466	PFAM	Tim17/Tim22/Tim23 family	JGI		ISS
UniRef100_G7K4C7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial import inner membrane translocase subunit TIM22 n=1 Tax=Medicago truncatula RepID=G7K4C7_MEDTR	SoyBase	E_val: 3.00E-57	ISS
UniRef100_UPI000233EFD8	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233EFD8 related cluster n=1 Tax=unknown RepID=UPI000233EFD8	SoyBase	E_val: 3.00E-116	ISS

Expression Patterns of Glyma18g09940

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g09940

Paralog	Evidence	Comments
Glyma08g43515	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g09940 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g086800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g09940

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g09940

Limit To All Plant Sequences

>Glyma18g09940.2   sequence type=CDS   gene model=Glyma18g09940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCATCGGATGTAACAGTTAATTCGGTTAGTGATGTGAACAATGCTCCCAATCATACAAAATCTGTAGGTCCTTCCTCTACTCCGTCGCTCACGGCTTCCCTTCTTCTCCCTGCCGCCACTAGCACTGCTTGTGGCGCCCTCACCGGCTCCCTTTTCGGCTATGGTGCTGGATTGATTAAGAAGAAAGGCTTTAAAGGATCCTTTATAGAAGCAGGATCTAATGCTAAGACATTTGCAATTTTATCCGGAGTTGATAGTTTGGTTGTCTGCATATTGGGAAGACTTCGAGGAAAGGATGATGCCATTAATGCTGGGGTAGCTGGATGCTGCGCTGGTCTTGCTACAAGTTTTCCTGGTACACCCCAATCACTTCTACAGAGCTGCATTGCTTATGGGGCACTTTCTTTTATCATTGAAGGGTTAACCAAGCAACGATCTGCACTTGCATATCCCATGTCCAAGAAAACAAGTGTACGCAACCAGGGTATAATTCCTACATCTCATTGA

Predicted protein sequences of Glyma18g09940

Limit To All Plant Sequences

>Glyma18g09940.2   sequence type=predicted peptide   gene model=Glyma18g09940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASDVTVNSVSDVNNAPNHTKSVGPSSTPSLTASLLLPAATSTACGALTGSLFGYGAGLIKKKGFKGSFIEAGSNAKTFAILSGVDSLVVCILGRLRGKDDAINAGVAGCCAGLATSFPGTPQSLLQSCIAYGALSFIIEGLTKQRSALAYPMSKKTSVRNQGIIPTSH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain