Report for Sequence Feature Glyma18g09550
Feature Type: gene_model
Chromosome: Gm18
Start: 8455419
stop: 8455756
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g09550
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G55460 AT
Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | chr5:22468698-22469133 FORWARD LENGTH=109
SoyBase E_val: 3.00E-18 ISS
GO:0006869 GO-bp
Annotation by Michelle Graham. GO Biological Process: lipid transport
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0008289 GO-mf
Annotation by Michelle Graham. GO Molecular Function: lipid binding
SoyBase N/A ISS
PF00234 PFAM
Protease inhibitor/seed storage/LTP family
JGI ISS
UniRef100_I1N0F8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N0F8_SOYBN
SoyBase E_val: 1.00E-46 ISS
UniRef100_O24101 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: MtN5 protein n=1 Tax=Medicago truncatula RepID=O24101_MEDTR
SoyBase E_val: 1.00E-16 ISS
Expression Patterns of Glyma18g09550
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma18g09550
Paralog Evidence Comments
Glyma08g43605 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g09550 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g085700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g09550
Coding sequences of Glyma18g09550
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g09550.2 sequence type=CDS gene model=Glyma18g09550 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
CATGTTTTATGTGACATAGAGTCAAATAAGCTAAACTTATGTTTTGAAGCAATTACTGGGAACCACCCTCCAAAACCCAATGAAAAATGCTGTGAAGTTGTTAAACATGCCAATTTGCCTTGCTTTTGCAGATACAAGTCTGTCCTACCTGCACTTGGAATCAACCCCGCCAATGCTTTTGCCTTGCCCCATAAATGTGGTCTGAAAACACCACCTGAATGTAGAGTGATTTGA
Predicted protein sequences of Glyma18g09550
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g09550.2 sequence type=predicted peptide gene model=Glyma18g09550 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
HVLCDIESNKLNLCFEAITGNHPPKPNEKCCEVVKHANLPCFCRYKSVLPALGINPANAFALPHKCGLKTPPECRVI*