SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g09380): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g09380): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g09380

Feature Type:gene_model
Chromosome:Gm18
Start:8238012
stop:8239816
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G60360AT Annotation by Michelle Graham. TAIR10: aleurain-like protease | chr5:24280044-24282152 FORWARD LENGTH=357 SoyBaseE_val: 4.00E-142ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0007568GO-bp Annotation by Michelle Graham. GO Biological Process: aging SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0042744GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0008234GO-mf Annotation by Michelle Graham. GO Molecular Function: cysteine-type peptidase activity SoyBaseN/AISS
KOG1543 KOG Cysteine proteinase Cathepsin L JGI ISS
PTHR12411Panther CYSTEINE PROTEASE FAMILY C1-RELATED JGI ISS
PTHR12411:SF50Panther gb def: granule-biosynthesis induced protease gip1p [tetrahymena thermophila] JGI ISS
PF00112PFAM Papain family cysteine protease JGI ISS
PF08246PFAM Cathepsin propeptide inhibitor domain (I29) JGI ISS
UniRef100_I1N0E7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1N0E7_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q1KK73UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cysteine protease n=1 Tax=Medicago sativa RepID=Q1KK73_MEDSA SoyBaseE_val: 7.00E-153ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g09380 not represented in the dataset

Glyma18g09380 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g084200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g09380.1   sequence type=CDS   gene model=Glyma18g09380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGCCGCCACGCTCTCTCCTTCGCCCGCTTCGCTTGTCGCCACGACAAGCGCTACCATTCTGTCGGCGAGATTCGCAACGACTTCCAGATCTTCTCTGATAATCTTAAACTCATCAGATCCACCAACAGGAGGTCTCTCACCTACACGCTTGGCGTCAATCATTTTGCTGACTGGACTTGGGAGGAGTTCACCAGACACAAGCTCGACGCTCCTCAGAATTGCTCTGCCACACTCAAAGGCAACCACAGGCTCACCGATGTTGTTCTTCCTGACGAGAAAGACTGGAGAAAAGAAGGTATAGTCAGCCAAGTTAAAGATCAAGGCAACTGCGGATCTTGCTGGACATTCAGCACAACTGGTGCATTGGAGGCAGCTTACACACAGGCCTTTGGGAAGAATATCAGTCTTTCTGAGCAGCAGCTAGTGGATTGTGCCGGTGCTTTCAATAACTTTGGCTGTAATGGTGGCTTGCCATCCCGGCTTGACACAGAGGAAGCATATCCCTACACCGGAAAAGATGGTGTCTGCAAATTTACAGCTAAAAACATTGCTGTTCAAGTCATTGACTCTATCAATATCACTTTGGGTGCTGAGGATGAATTGAAACAAGTGGTTGCTTTTGTTTGGCCAGTTAGTGTGGCATTTGAGGTAGTGAAGGACTTCCGATTCTACAATAATGGAGTTTACACTAGTACCATTTGTGGTAGCACGCCCATGGATGTAAATCATGTTGTTCTTGCTGTTGGGTATGGAGTTGAAGATGGTGTTCCGTATTGGATCATTAAAAATTCTAATCCTTTATATTGTGGCAAGGGCCTTTTTGATTGTGATACCGAAAGCAATTACAAAAAATTCTAA

>Glyma18g09380.1   sequence type=predicted peptide   gene model=Glyma18g09380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SRHALSFARFACRHDKRYHSVGEIRNDFQIFSDNLKLIRSTNRRSLTYTLGVNHFADWTWEEFTRHKLDAPQNCSATLKGNHRLTDVVLPDEKDWRKEGIVSQVKDQGNCGSCWTFSTTGALEAAYTQAFGKNISLSEQQLVDCAGAFNNFGCNGGLPSRLDTEEAYPYTGKDGVCKFTAKNIAVQVIDSINITLGAEDELKQVVAFVWPVSVAFEVVKDFRFYNNGVYTSTICGSTPMDVNHVVLAVGYGVEDGVPYWIIKNSNPLYCGKGLFDCDTESNYKKF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo