SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g09261

Feature Type:gene_model
Chromosome:Gm18
Start:8129430
stop:8130512
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G25220AT Annotation by Michelle Graham. TAIR10: KNOTTED1-like homeobox gene 3 | chr5:8736208-8738115 FORWARD LENGTH=431 SoyBaseE_val: 6.00E-22ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0009722GO-bp Annotation by Michelle Graham. GO Biological Process: detection of cytokinin stimulus SoyBaseN/AISS
GO:0048513GO-bp Annotation by Michelle Graham. GO Biological Process: organ development SoyBaseN/AISS
GO:0071345GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to cytokine stimulus SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PTHR11850Panther HOMEOBOX PROTEIN JGI ISS
PTHR11850:SF15Panther HOMEOBOX PROTEIN KNOTTED-1 JGI ISS
PF03791PFAM KNOX2 domain JGI ISS
UniRef100_I1JUA0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JUA0_SOYBN SoyBaseE_val: 3.00E-48ISS
UniRef100_P48000UniRef Annotation by Michelle Graham. Most informative UniRef hit: Homeobox protein knotted-1-like 3 n=1 Tax=Arabidopsis thaliana RepID=KNAT3_ARATH SoyBaseE_val: 3.00E-19ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g09261 not represented in the dataset

Glyma18g09261 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g083100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g09261.1   sequence type=CDS   gene model=Glyma18g09261   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTGCAGTCCCACTATGTTCTGTTGCTCTGTTCTTTCAAAGAACAACTTCAACAGCATGTCCGGGTCCATGCAATGGAAGCAGTCATGGTTTGTTGGGAGATTGAGCAATCCTTACAAAGTTTAACAGGTACAGCGATAGTCTTTTTAGTGATTGTTACATCTCAACATAAAAATAAACCAATAAAGGTTGGGTACATGATAAAATGGAAATCAGTACCAGAAAATGATAAAATGGAAATAACTTGA

>Glyma18g09261.1   sequence type=predicted peptide   gene model=Glyma18g09261   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLQSHYVLLLCSFKEQLQQHVRVHAMEAVMVCWEIEQSLQSLTGTAIVFLVIVTSQHKNKPIKVGYMIKWKSVPENDKMEIT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo