Report for Sequence Feature Glyma18g09190
Feature Type: gene_model
Chromosome: Gm18
Start: 8054423
stop: 8056565
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g09190
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G38770 AT
Annotation by Michelle Graham. TAIR10: P-loop containing nucleoside triphosphate hydrolases superfamily protein | chr2:16203185-16210253 REVERSE LENGTH=1509
SoyBase E_val: 5.00E-27 ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
PTHR10887 Panther
DNA2/NAM7 HELICASE FAMILY
JGI ISS
PTHR10887:SF5 Panther
RIBONUCLEASE-RELATED
JGI ISS
UniRef100_G7IBG5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Myosin-like protein n=1 Tax=Medicago truncatula RepID=G7IBG5_MEDTR
SoyBase E_val: 6.00E-26 ISS
UniRef100_UPI000233EEC7 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233EEC7 related cluster n=1 Tax=unknown RepID=UPI000233EEC7
SoyBase E_val: 8.00E-28 ISS
Expression Patterns of Glyma18g09190
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma18g09190 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g082500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g09190
Coding sequences of Glyma18g09190
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g09190.1 sequence type=CDS gene model=Glyma18g09190 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAGTTACTCGATAGAAATTTGCAGAGACCAAATTTCTTTAAAGCTAGATGATCATGTTAAACTGAGCCCTCTGTACAAGAAAGATGGGGTTGAAGATGATTTAGGAAGTAACCTGTGGCAAGTCTTCTATCACAAGTTTCTCATTCACTTTCTGTCTTGTGCAACTGTCTATCCACAATATCTGATTAATATTCCTTCCCTTCAACTTTTACGTGCTAATCTGTCCAAGAAATTGTCTGTTCTTTCTCCGGAGGAGTTAAGAGATTTTGTTTGCTGTAAGGTATTTACATATACAGATAATCAAGTTCCTCCTCAAGATCATGGCCCCTATCCTCAAGCACTAATTATTGAGACATATACTCCTCCAGATCCTGGCCCCTATCCTCAAGATCAGCCTAAACAAAATTCAGTTCGATTTACACCCACCCAGGTTGAAGCAATCATCTCTGGCATTCAGCCTGGTCTAATTATGGTTGTGGGGCCACCTAGTACAGGAAAGACTGATCAACAAAGTGTAATTAAGAATTAG
Predicted protein sequences of Glyma18g09190
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g09190.1 sequence type=predicted peptide gene model=Glyma18g09190 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSYSIEICRDQISLKLDDHVKLSPLYKKDGVEDDLGSNLWQVFYHKFLIHFLSCATVYPQYLINIPSLQLLRANLSKKLSVLSPEELRDFVCCKVFTYTDNQVPPQDHGPYPQALIIETYTPPDPGPYPQDQPKQNSVRFTPTQVEAIISGIQPGLIMVVGPPSTGKTDQQSVIKN*