Report for Sequence Feature Glyma18g08900
Feature Type: gene_model
Chromosome: Gm18
Start: 7631151
stop: 7635558
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g08900
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G13120 AT
Annotation by Michelle Graham. TAIR10: Ribosomal protein S10p/S20e family protein | chr3:4220310-4221526 REVERSE LENGTH=191
SoyBase E_val: 9.00E-76 ISS
GO:0006364 GO-bp
Annotation by Michelle Graham. GO Biological Process: rRNA processing
SoyBase N/A ISS
GO:0006412 GO-bp
Annotation by Michelle Graham. GO Biological Process: translation
SoyBase N/A ISS
GO:0009902 GO-bp
Annotation by Michelle Graham. GO Biological Process: chloroplast relocation
SoyBase N/A ISS
GO:0010027 GO-bp
Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization
SoyBase N/A ISS
GO:0015979 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosynthesis
SoyBase N/A ISS
GO:0015995 GO-bp
Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process
SoyBase N/A ISS
GO:0019288 GO-bp
Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway
SoyBase N/A ISS
GO:0034660 GO-bp
Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0009570 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma
SoyBase N/A ISS
GO:0015935 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit
SoyBase N/A ISS
GO:0003723 GO-mf
Annotation by Michelle Graham. GO Molecular Function: RNA binding
SoyBase N/A ISS
GO:0003735 GO-mf
Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome
SoyBase N/A ISS
KOG0900
KOG
40S ribosomal protein S20
JGI ISS
PTHR11700 Panther
30S RIBOSOMAL PROTEIN S10 FAMILY MEMBER
JGI ISS
PTHR11700:SF5 Panther
SUBFAMILY NOT NAMED
JGI ISS
PF00338 PFAM
Ribosomal protein S10p/S20e
JGI ISS
UniRef100_B9S9Q5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: 30S ribosomal protein S10, putative n=1 Tax=Ricinus communis RepID=B9S9Q5_RICCO
SoyBase E_val: 3.00E-83 ISS
UniRef100_I1N0C3 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N0C3_SOYBN
SoyBase E_val: 3.00E-146 ISS
Expression Patterns of Glyma18g08900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma18g08900
Paralog Evidence Comments
Glyma08g43950 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g08900 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g079900 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g08900
Coding sequences of Glyma18g08900
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g08900.3 sequence type=CDS gene model=Glyma18g08900 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCGGTTTCTCTCTCTGTTACTCCTCTTTCTCTCTCCAATTCTTCTCCTTCTCTATCTTCCAAGCCAAAGTTTCCATCTTTGTGCTTTTTCTCTGGCAACAACACCTTGAGGGTCAAATGCCCAAAACCTTCGCACTCAACAACTGTTGTTCATGTTGCTCCAGAAGCGTTGGATTCTTCACTTGATCCCTTAGACCCACCTCCAGAAACCCTTGATGATGACTCTGACGCCACCACCTTTGAGGTTGGTGACTTGGGGACTCCTAGCACTTCGGCAATTAGCATTGGTGGCGATGCAGATACAATGGCACCAAAGCAGAAGATTAGAATCAAGCTTAGATCTTACTGGGTGCCCTTGATAGAGGATTCCTGCAAGCAGATATTAGATGCAGCAAGGAATACCAATGCAAAAACGATGGGACCTGTGCCATTACCAACCAAGAAGCGAATCTACTGTGTTCTTAAATCCCCACACGTACATAAGGATGCTCGGTTCCATTTCGAGATCAGAACACACCAGCGTCTCATTGATATTCTATACCCTACAGCTCAAACAATAGATTCTCTGATGCAACTAGATCTTCCTGCTGGTGTTGATGTGGAGGTCAAGCTCTAG
Predicted protein sequences of Glyma18g08900
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g08900.3 sequence type=predicted peptide gene model=Glyma18g08900 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAVSLSVTPLSLSNSSPSLSSKPKFPSLCFFSGNNTLRVKCPKPSHSTTVVHVAPEALDSSLDPLDPPPETLDDDSDATTFEVGDLGTPSTSAISIGGDADTMAPKQKIRIKLRSYWVPLIEDSCKQILDAARNTNAKTMGPVPLPTKKRIYCVLKSPHVHKDARFHFEIRTHQRLIDILYPTAQTIDSLMQLDLPAGVDVEVKL*