Report for Sequence Feature Glyma18g08705
Feature Type: gene_model
Chromosome: Gm18
Start: 7434767
stop: 7437249
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g08705
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G16400 AT
Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G13175.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr4:9260564-9262102 FORWARD LENGTH=218
SoyBase E_val: 7.00E-22 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005575 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cellular component
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_C8YZB6 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: UPA24 n=1 Tax=Capsicum annuum RepID=C8YZB6_CAPAN
SoyBase E_val: 8.00E-12 ISS
UniRef100_I1N0B1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N0B1_SOYBN
SoyBase E_val: 4.00E-61 ISS
Expression Patterns of Glyma18g08705
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma18g08705
Paralog Evidence Comments
Glyma08g44080 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g08705 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g078100 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g08705
Coding sequences of Glyma18g08705
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g08705.1 sequence type=CDS gene model=Glyma18g08705 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTTTTTTTTTTTTTCCACCTTTTCCTCTCTCTCTCTCTCTCTTCACATTATAAACCTCTCTCCATTTCACACTCCTCCACTCACAAACCCATCACCGTCACTATCCACCATTTCCCTTTCTTTCCTTCTTCTTCCCATGGAGATCCAACAACAACTGTTGAAGTTCAGGTACCACATCGGAGTGGCACTCCTCGTGTCCCTCTCGGTCTTCTCCGTGCTCCACTTCGCTCCGAGGTTCCTCAACATCCTCGCCTATTTCTGGCCACTGTTTCTCTCCACTGCGCTTTTTCTCGCCCTCGTTCTCTTCTTCGCCAAGACGCAAACTTCGCTCAACTCCGACGCTTCCCTTCCCAAACCCGCCGAGGAGCTCCTCGACTTCGTCGCCGGCCACCACCACGACCCTCCTCTCGACGCCCACAAGTCCGATTAG
Predicted protein sequences of Glyma18g08705
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g08705.1 sequence type=predicted peptide gene model=Glyma18g08705 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MFFFFSTFSSLSLSLHIINLSPFHTPPLTNPSPSLSTISLSFLLLPMEIQQQLLKFRYHIGVALLVSLSVFSVLHFAPRFLNILAYFWPLFLSTALFLALVLFFAKTQTSLNSDASLPKPAEELLDFVAGHHHDPPLDAHKSD*