SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g08530): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g08530): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g08530

Feature Type:gene_model
Chromosome:Gm18
Start:7260758
stop:7263719
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G55730AT Annotation by Michelle Graham. TAIR10: FASCICLIN-like arabinogalactan 1 | chr5:22558375-22560392 REVERSE LENGTH=424 SoyBaseE_val: 3.00E-131ISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0048367GO-bp Annotation by Michelle Graham. GO Biological Process: shoot development SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0046658GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane SoyBaseN/AISS
PTHR10900Panther TRANSFORMING GROWTH FACTOR JGI ISS
PTHR10900:SF23Panther FLA (FASCICLIN-LIKE ARABINOGALACTAN PROTEIN) JGI ISS
PF02469PFAM Fasciclin domain JGI ISS
UniRef100_A9XTL5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Fasciclin-like arabinogalactan protein 10 n=1 Tax=Gossypium hirsutum RepID=A9XTL5_GOSHI SoyBaseE_val: 4.00E-158ISS
UniRef100_UPI000233ECDAUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233ECDA related cluster n=1 Tax=unknown RepID=UPI000233ECDA SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g08530 not represented in the dataset

Glyma18g08530 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma08g44210 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g076600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g08530.1   sequence type=CDS   gene model=Glyma18g08530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGCTCCTCCGGGCGGTGCTCGCGGCGGCGCTGCTCCTCCTCGCCACTCTCTCCGACGCCCACAACATCACAACCATCCTCTCAAAGCACCCTGAGTTCTCCACCTTCAACCACTACCTGACCCTGACCCACCTGGCCCCGGAAATCAACGGCAAAACCACCATCACCGTCTGCGCCGTGGACAACGCCGCCATGTCGGACCTCCTCAGCAAGCACCCCTCCATTTACACCATCAAGAACATCCTCTCCCTCCACGTCCTCCTCGACTACTTCGGCGCCAAGAAGCTCCACCAGATCACCAACGGCACCGCCCTCGCCGCCACCATGTACCAGGCCACCGGCAGCGCTCCCGGATCCGCCGGCTTCGTCAACATCACCGACCTCCACGGCGGAAAGGTCGGCTTCGGCGCCGAAAACAACGACGGCACACTCTCCTCAACTTTCGTCAAATCCGTAGAAGAAATCCCTTACAACATCTCAGTAATCCAGATCAGCAAAGTTCTCCCCTCTGCCGCAGCGGAAGCCCCTGCACCCGCACCCACCCAACAAAACCTCACCAACATTATGTCAAAACACGGATGCAAGGTCTTCGCCGACGCTCTCTCTGCTCAACCCGACGCGCTTAACACCTTCAATGACAACCTCGATGGGGGCTTAACCGTCTTTTGCCCCCTCGACGACGCGTTCAAAGCGTTTCTCCCCAAATTCAAAAACCTAACCAAATCCGGTAAGGTCGCGCTTCTCGAATTCCACGGTGTTCCGGTTTACCAGTCCAAAGCCACTCTCAAATCCAACAACGGACTTCAGAACACTCTCGCCACTGATGGCGCTAACAAGTTCGACTTCACTGTTCAGAACGACGGTGAAGATGTTACTCTGAAAACGAAGCTCACCACTGCGAAGATCACCGACACATTTGTTTAA

>Glyma18g08530.1   sequence type=predicted peptide   gene model=Glyma18g08530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQLLRAVLAAALLLLATLSDAHNITTILSKHPEFSTFNHYLTLTHLAPEINGKTTITVCAVDNAAMSDLLSKHPSIYTIKNILSLHVLLDYFGAKKLHQITNGTALAATMYQATGSAPGSAGFVNITDLHGGKVGFGAENNDGTLSSTFVKSVEEIPYNISVIQISKVLPSAAAEAPAPAPTQQNLTNIMSKHGCKVFADALSAQPDALNTFNDNLDGGLTVFCPLDDAFKAFLPKFKNLTKSGKVALLEFHGVPVYQSKATLKSNNGLQNTLATDGANKFDFTVQNDGEDVTLKTKLTTAKITDTFV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo