SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g08260

Feature Type:gene_model
Chromosome:Gm18
Start:7038964
stop:7040911
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g08260
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G55980AT Annotation by Michelle Graham. TAIR10: serine-rich protein-related | chr5:22670301-22670642 FORWARD LENGTH=113 SoyBaseE_val: 2.00E-14ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009693GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1N082UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N082_SOYBN SoyBaseE_val: 6.00E-57ISS
UniRef100_Q9FKU6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Serine-rich protein-like protein n=1 Tax=Arabidopsis thaliana RepID=Q9FKU6_ARATH SoyBaseE_val: 1.00E-11ISS

Expression Patterns of Glyma18g08260
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g08260
ParalogEvidenceComments
Glyma08g44541 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g08260 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g074500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g08260
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g08260
>Glyma18g08260.2   sequence type=CDS   gene model=Glyma18g08260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGCCAAAGGTGGAGCAAAAGCCCCCAAGGATGAAGTTAAGTAAACTCCCTGAGTTGGACGTGGAAACCTTCCAGAATTCACATGTGCTTGTGTCACCAACAACATCTCAGAATTCACATATGTTCATGTCACCAACATCTCAACCCATAACCCGAAAAAATTCAAATGGAAGGTTGAACTGTCTATGCTCACCCACCACACATGCTGGTTCCTTTAGATGTCGACACCATCGATCTTCTGGAATTCGTCGGGGCAAATCCGTTGGTTCTAACCTTGCTGAATTGGGGTCTAAAGCAGGCTCAATCAGTGACTCACTCCATGCTCAATAG
Predicted protein sequences of Glyma18g08260
>Glyma18g08260.2   sequence type=predicted peptide   gene model=Glyma18g08260   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEPKVEQKPPRMKLSKLPELDVETFQNSHVLVSPTTSQNSHMFMSPTSQPITRKNSNGRLNCLCSPTTHAGSFRCRHHRSSGIRRGKSVGSNLAELGSKAGSISDSLHAQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo