Glyma18g07890 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g07890

Feature Type:	gene_model
Chromosome:	Gm18
Start:	6636288
stop:	6639893
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g07890

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G12840	AT	Annotation by Michelle Graham. TAIR10: nuclear factor Y, subunit A1 \| chr5:4051147-4052961 REVERSE LENGTH=271	SoyBase	E_val: 3.00E-89	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009790	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0010262	GO-bp	Annotation by Michelle Graham. GO Biological Process: somatic embryogenesis	SoyBase	N/A	ISS
GO:0048316	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed development	SoyBase	N/A	ISS
GO:0048510	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of timing of transition from vegetative to reproductive phase	SoyBase	N/A	ISS
GO:0055046	GO-bp	Annotation by Michelle Graham. GO Biological Process: microgametogenesis	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0016602	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: CCAAT-binding factor complex	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
KOG1561	KOG	CCAAT-binding factor, subunit B (HAP2)	JGI		ISS
PTHR12632	Panther	TRANSCRIPTION FACTOR NF-Y ALPHA-RELATED	JGI		ISS
PF02045	PFAM	CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B	JGI		ISS
UniRef100_G7IYA4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nuclear transcription factor Y subunit n=5 Tax=Medicago truncatula RepID=G7IYA4_MEDTR	SoyBase	E_val: 3.00E-174	ISS
UniRef100_UPI000233F259	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233F259 related cluster n=1 Tax=unknown RepID=UPI000233F259	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma18g07890

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g07890

Paralog	Evidence	Comments
Glyma08g45030	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g07890 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g071000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g07890

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g07890

Limit To All Plant Sequences

>Glyma18g07890.2   sequence type=CDS   gene model=Glyma18g07890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGTCCAAGTCTGAAACTGCAAATCGACTGAGATCAGATCCTCATTCCTTTCAACCTGGCAGTGTTTATTCTGAGCCTTGGTGGCGTGGTATTGGGTACAATCCTGTGGCCCAGACAATGGCTGGGGCAAATGCATCCAATTCATCGTCTCTTGAATGCCCTAATGGTGATTCTGAATCCAATGAAGAAGGTCAGTCTTTGTCCAATAGCGGGATGAATGAGGAAGATGATGATGCCACTAAGGATTCACAGCCTGCTGCTCCTAATGGAACAGGAAATTATGGGCAAGAACAGCAAGGGATGCAGCATACTGCATCATCTGCACCCTCCATGCGTGAAGAATGCCTTACTCAGACACCACAGCTGGAACTTGTCGGTCATTCAATTGCATGTGCTACAAATCCTTATCAGGATCCGTATTATGGGGGCATGATGGCAGCTTATGGTCACCAACAGTTGGGATATGCTCCTTTTATAGGAATGCCTCATGCCAGAATGCCTTTGCCCCTTGAGATGGCTCAAGAACCTGTGTATGTGAATGCCAAACAGTACCAAGGAATTCTGAGGCGAAGACAGGCTCGTGCTAAAGCAGAGCTTGAAAGGAAGCTCATAAAATCTAGAAAGCCATATCTTCATGAATCTAGGCATCAGCATGCTATGAGAAGGGCAAGGGGTACTGGAGGACGATTTGCAAAGAAAACTGACGGTGAGGGCTCAAACCACTCAGGCAAGGAAAAGGATAATGGTACTGATTCTGTCCTATCATCACAATCAATTAGTTCATCTGGTTCTGAACCTTTACATTCTGACTCTGCCGAAACCTGGAATTCTCCTAACATGCAACAAGATGCAAGAGCATCAAAAGTGCACAACAGGTTCAAAGCACCCTGTTACCAAAATGGCAGTGGCTCCTACCATAATCATAATGGATTGCAATCTTCAGTGTACCATTCATCCTCAGGTGAAAGACTGGAGGAAAGGGATTGTTCGGGTCAGCAACTGAACCACAATTGA

Predicted protein sequences of Glyma18g07890

Limit To All Plant Sequences

>Glyma18g07890.2   sequence type=predicted peptide   gene model=Glyma18g07890   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQSKSETANRLRSDPHSFQPGSVYSEPWWRGIGYNPVAQTMAGANASNSSSLECPNGDSESNEEGQSLSNSGMNEEDDDATKDSQPAAPNGTGNYGQEQQGMQHTASSAPSMREECLTQTPQLELVGHSIACATNPYQDPYYGGMMAAYGHQQLGYAPFIGMPHARMPLPLEMAQEPVYVNAKQYQGILRRRQARAKAELERKLIKSRKPYLHESRHQHAMRRARGTGGRFAKKTDGEGSNHSGKEKDNGTDSVLSSQSISSSGSEPLHSDSAETWNSPNMQQDARASKVHNRFKAPCYQNGSGSYHNHNGLQSSVYHSSSGERLEERDCSGQQLNHN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain