SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g07310

Feature Type:gene_model
Chromosome:Gm18
Start:5991450
stop:5992152
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g07310
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G47070AT Annotation by Michelle Graham. TAIR10: LOCATED IN: thylakoid, chloroplast thylakoid membrane, chloroplast, chloroplast envelope; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Thylakoid soluble phosphoprotein TSP9 (InterPro:IPR021584); Has 37 Blast hits to 37 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 37; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:17337205-17337507 REVERSE LENGTH=100 SoyBaseE_val: 4.00E-19ISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0009902GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast relocation SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0010218GO-bp Annotation by Michelle Graham. GO Biological Process: response to far red light SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0034660GO-bp Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process SoyBaseN/AISS
GO:0070838GO-bp Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
PF11493PFAM Thylakoid soluble phosphoprotein TSP9 JGI ISS
UniRef100_I1N020UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N020_SOYBN SoyBaseE_val: 1.00E-57ISS
UniRef100_I6Y9K3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Thylakoid soluble phosphoprotein n=1 Tax=Linum usitatissimum RepID=I6Y9K3_LINUS SoyBaseE_val: 3.00E-19ISS

Expression Patterns of Glyma18g07310
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g07310
ParalogEvidenceComments
Glyma11g26491 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g07310 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g065900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g07310
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g07310
>Glyma18g07310.1   sequence type=CDS   gene model=Glyma18g07310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCCATCATCATGTCATTTGCTCCAGCAACTGGTAGAGTCTTTGCAGCCACAGCGGCAAAGGGTGCTGGTGGAAGCAAAGAAGAGAAGGGTCTTCTTGATTGGATCCTTGGAGGGTTGCAGAAGGAAGACCAGCTGCTAGAGACTGATCCAATCCTCAAGAAGGTGGAGGAGAAGAATGGAGGCACCACCAGCAACACTGGCCGCAACAAGAACTCTGTGGCAGTGCCACAAAAGAAGAAAGGTGGCTTTGGAGGCCTCTTTGCGAAGAACTGA
Predicted protein sequences of Glyma18g07310
>Glyma18g07310.1   sequence type=predicted peptide   gene model=Glyma18g07310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASIIMSFAPATGRVFAATAAKGAGGSKEEKGLLDWILGGLQKEDQLLETDPILKKVEEKNGGTTSNTGRNKNSVAVPQKKKGGFGGLFAKN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo