SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma18g06720

Feature Type:gene_model
Chromosome:Gm18
Start:5316526
stop:5322727
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G58575AT Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: Sgf11, transcriptional regulation (InterPro:IPR013246); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:23674399-23675224 FORWARD LENGTH=181 SoyBaseE_val: 1.00E-72ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG2612 KOG Predicted integral membrane protein JGI ISS
PF08209PFAM Sgf11 (transcriptional regulation protein) JGI ISS
UniRef100_C6T7E5UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T7E5_SOYBN SoyBaseE_val: 3.00E-140ISS
UniRef100_Q94BV2UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT5g58570/mzn1_20 n=1 Tax=Arabidopsis thaliana RepID=Q94BV2_ARATH SoyBaseE_val: 5.00E-70ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g060000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g06720.2   sequence type=CDS   gene model=Glyma18g06720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTAGTCACAGTAGTATACCTTCTATCATATTTGTATTTCTTTGTATTGTGGAATAACTCTGACGTGAATGTGCCTAAACTTTCTTATTTTTTCTTGGATCTCCTTGATTCCATCATAGTCGACGTGGCATCAGAGTGTCACAGAGTAGCAAGGCTGGGGCTTGATTCAAATTTGGAAGAAGAGGATGAAGAATTGAAGCTGTCAGCACAAGCCAGGGTTAGGGTGGCTGATCCTAGTAACAGTAATGAAGCAAATGGCAAGTATGTGGTTGACATATTTGGACAAACTCATCCTCCTGTGGCAAATGAAATATTTGATTGTTTGAATTGTGGTCGATCCATCATGGCTGGAAGGTTTGCTCCACATTTGGAGAAGTGCATGGGAAAGGGTAGGAAGGCACGTCTGAAAGTGACAAGAAGCAGCACAGCCACGCAGAACCGGTATTCACGAGGCGGTCCCAGTCCTGGTTCTACACATTCTCCATATTCAAATTACTCTACCAATAGCATGAATCGGTTGGCATATGGAACCTCCACTTTTGCAGGTGAGGAGCACTCAAATGGGACACTCGAGTCATGA

>Glyma18g06720.2   sequence type=predicted peptide   gene model=Glyma18g06720   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLVTVVYLLSYLYFFVLWNNSDVNVPKLSYFFLDLLDSIIVDVASECHRVARLGLDSNLEEEDEELKLSAQARVRVADPSNSNEANGKYVVDIFGQTHPPVANEIFDCLNCGRSIMAGRFAPHLEKCMGKGRKARLKVTRSSTATQNRYSRGGPSPGSTHSPYSNYSTNSMNRLAYGTSTFAGEEHSNGTLES*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo