Report for Sequence Feature Glyma18g06720
Feature Type: gene_model
Chromosome: Gm18
Start: 5316526
stop: 5322727
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g06720
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G58575 AT
Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: Sgf11, transcriptional regulation (InterPro:IPR013246); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:23674399-23675224 FORWARD LENGTH=181
SoyBase E_val: 1.00E-72 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
KOG2612
KOG
Predicted integral membrane protein
JGI ISS
PF08209 PFAM
Sgf11 (transcriptional regulation protein)
JGI ISS
UniRef100_C6T7E5 UniRef
Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T7E5_SOYBN
SoyBase E_val: 3.00E-140 ISS
UniRef100_Q94BV2 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: AT5g58570/mzn1_20 n=1 Tax=Arabidopsis thaliana RepID=Q94BV2_ARATH
SoyBase E_val: 5.00E-70 ISS
Expression Patterns of Glyma18g06720
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma18g06720 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g060000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g06720
Coding sequences of Glyma18g06720
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g06720.2 sequence type=CDS gene model=Glyma18g06720 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCTAGTCACAGTAGTATACCTTCTATCATATTTGTATTTCTTTGTATTGTGGAATAACTCTGACGTGAATGTGCCTAAACTTTCTTATTTTTTCTTGGATCTCCTTGATTCCATCATAGTCGACGTGGCATCAGAGTGTCACAGAGTAGCAAGGCTGGGGCTTGATTCAAATTTGGAAGAAGAGGATGAAGAATTGAAGCTGTCAGCACAAGCCAGGGTTAGGGTGGCTGATCCTAGTAACAGTAATGAAGCAAATGGCAAGTATGTGGTTGACATATTTGGACAAACTCATCCTCCTGTGGCAAATGAAATATTTGATTGTTTGAATTGTGGTCGATCCATCATGGCTGGAAGGTTTGCTCCACATTTGGAGAAGTGCATGGGAAAGGGTAGGAAGGCACGTCTGAAAGTGACAAGAAGCAGCACAGCCACGCAGAACCGGTATTCACGAGGCGGTCCCAGTCCTGGTTCTACACATTCTCCATATTCAAATTACTCTACCAATAGCATGAATCGGTTGGCATATGGAACCTCCACTTTTGCAGGTGAGGAGCACTCAAATGGGACACTCGAGTCATGA
Predicted protein sequences of Glyma18g06720
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g06720.2 sequence type=predicted peptide gene model=Glyma18g06720 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MLVTVVYLLSYLYFFVLWNNSDVNVPKLSYFFLDLLDSIIVDVASECHRVARLGLDSNLEEEDEELKLSAQARVRVADPSNSNEANGKYVVDIFGQTHPPVANEIFDCLNCGRSIMAGRFAPHLEKCMGKGRKARLKVTRSSTATQNRYSRGGPSPGSTHSPYSNYSTNSMNRLAYGTSTFAGEEHSNGTLES*