Glyma18g06270 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g06270

Feature Type:	gene_model
Chromosome:	Gm18
Start:	4848456
stop:	4850447
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g06270

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G56220	AT	Annotation by Michelle Graham. TAIR10: transcription regulators \| chr3:20858941-20860302 FORWARD LENGTH=156	SoyBase	E_val: 3.00E-39	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
UniRef100_C6SW93	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SW93_SOYBN	SoyBase	E_val: 1.00E-103	ISS
UniRef100_G7K7C1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor bHLH93 n=1 Tax=Medicago truncatula RepID=G7K7C1_MEDTR	SoyBase	E_val: 1.00E-35	ISS

Expression Patterns of Glyma18g06270

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g06270

Paralog	Evidence	Comments
Glyma11g29830	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g06270 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g055800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g06270

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g06270

Limit To All Plant Sequences

>Glyma18g06270.1   sequence type=CDS   gene model=Glyma18g06270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTTCCAGGGTTCACAAGAGAACAGCCATGTACAGGAACCTACACCTGCTTCGTTCAATCAGATACTCACACTCGGTGTCAGATTACATACAAGGTTTAAAGCAAAAACTGGAAGAATTGAACCAGTTAACAGTGGCAACGGCACGAAAAATCGTTGACTATGATCCAATGCCTAAGCTTGAAGTTGAAACACAAGAAGAGGGTTTTGTGATCAAGGTGCTGAGTGAAAGCAGTTGCCAGGGGTTGCTGGTGTTTATATTGGAAGCCTTTGAAGAGCTGGGGCTTGATGTGCTCCAAGCTAGGGTTTCTTGTGCGCACAGCTTCAGTTTAGAAGCTCTCGGAAACAAAGAGAACAATGAAGATACTCGCCCATTGGATGCACAACTAGTTGAGCAAGTAGTGTCTCAAGCTATTCAAAACTGGAGGGAAGTTTCACAGATATAA

Predicted protein sequences of Glyma18g06270

Limit To All Plant Sequences

>Glyma18g06270.1   sequence type=predicted peptide   gene model=Glyma18g06270   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVSRVHKRTAMYRNLHLLRSIRYSHSVSDYIQGLKQKLEELNQLTVATARKIVDYDPMPKLEVETQEEGFVIKVLSESSCQGLLVFILEAFEELGLDVLQARVSCAHSFSLEALGNKENNEDTRPLDAQLVEQVVSQAIQNWREVSQI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain