SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g06110): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g06110): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g06110

Feature Type:gene_model
Chromosome:Gm18
Start:4696755
stop:4700135
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G31720AT Annotation by Michelle Graham. TAIR10: TBP-associated factor II 15 | chr4:15354223-15355704 REVERSE LENGTH=134 SoyBaseE_val: 7.00E-71ISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0006352GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, initiation SoyBaseN/AISS
GO:0006366GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from RNA polymerase II promoter SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PTHR21242Panther TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 10 JGI ISS
PF03540PFAM Transcription initiation factor TFIID 23-30kDa subunit JGI ISS
UniRef100_G7KSG1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription initiation factor TFIID subunit n=1 Tax=Medicago truncatula RepID=G7KSG1_MEDTR SoyBaseE_val: 4.00E-88ISS
UniRef100_I1MZR9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MZR9_SOYBN SoyBaseE_val: 5.00E-96ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g06110 not represented in the dataset

Glyma18g06110 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g054400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g06110.1   sequence type=CDS   gene model=Glyma18g06110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACCAGAACCCGCAATCGAGTGAAGGAAGGAACGATGACGATTCTGCCCTTTCTGATTTCCTCGCTTCCTTAATGGATTATACTCCCACTATACCTGATGAATTGGTGGAGCATTACTTGGCCAAGAGCGGTTTCCAATGTCCCGATGTTCGATTGACTAGATTGGTAGCTGTTGCCACTCAGAAGTTTGTTGCTGAAGTTGCAGGAGATGCACTTCAGCACTGCAAAGCAAGACAAGCAACAATTCCAAAAGACAAAAGGGACAAGCAGCAGAAGGATAAGCGCCTAGTTTTGACAATGGAAGACCTTTCAAAGGCATTGCGTGAGTATGGCGTGAATTTAAAGCATCAAGAATATTTTGCTGATAGCCCTTCTACCGGAATGGATCCTGCTACCCGAGAAGAATGA

>Glyma18g06110.1   sequence type=predicted peptide   gene model=Glyma18g06110   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNQNPQSSEGRNDDDSALSDFLASLMDYTPTIPDELVEHYLAKSGFQCPDVRLTRLVAVATQKFVAEVAGDALQHCKARQATIPKDKRDKQQKDKRLVLTMEDLSKALREYGVNLKHQEYFADSPSTGMDPATREE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo