Report for Sequence Feature Glyma18g06110
Feature Type: gene_model
Chromosome: Gm18
Start: 4696755
stop: 4700135
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g06110
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G31720 AT
Annotation by Michelle Graham. TAIR10: TBP-associated factor II 15 | chr4:15354223-15355704 REVERSE LENGTH=134
SoyBase E_val: 7.00E-71 ISS
GO:0000394 GO-bp
Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation
SoyBase N/A ISS
GO:0006352 GO-bp
Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, initiation
SoyBase N/A ISS
GO:0006366 GO-bp
Annotation by Michelle Graham. GO Biological Process: transcription from RNA polymerase II promoter
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
PTHR21242 Panther
TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 10
JGI ISS
PF03540 PFAM
Transcription initiation factor TFIID 23-30kDa subunit
JGI ISS
UniRef100_G7KSG1 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Transcription initiation factor TFIID subunit n=1 Tax=Medicago truncatula RepID=G7KSG1_MEDTR
SoyBase E_val: 4.00E-88 ISS
UniRef100_I1MZR9 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MZR9_SOYBN
SoyBase E_val: 5.00E-96 ISS
Expression Patterns of Glyma18g06110
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma18g06110 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g054400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g06110
Coding sequences of Glyma18g06110
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g06110.1 sequence type=CDS gene model=Glyma18g06110 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAACCAGAACCCGCAATCGAGTGAAGGAAGGAACGATGACGATTCTGCCCTTTCTGATTTCCTCGCTTCCTTAATGGATTATACTCCCACTATACCTGATGAATTGGTGGAGCATTACTTGGCCAAGAGCGGTTTCCAATGTCCCGATGTTCGATTGACTAGATTGGTAGCTGTTGCCACTCAGAAGTTTGTTGCTGAAGTTGCAGGAGATGCACTTCAGCACTGCAAAGCAAGACAAGCAACAATTCCAAAAGACAAAAGGGACAAGCAGCAGAAGGATAAGCGCCTAGTTTTGACAATGGAAGACCTTTCAAAGGCATTGCGTGAGTATGGCGTGAATTTAAAGCATCAAGAATATTTTGCTGATAGCCCTTCTACCGGAATGGATCCTGCTACCCGAGAAGAATGA
Predicted protein sequences of Glyma18g06110
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g06110.1 sequence type=predicted peptide gene model=Glyma18g06110 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MNQNPQSSEGRNDDDSALSDFLASLMDYTPTIPDELVEHYLAKSGFQCPDVRLTRLVAVATQKFVAEVAGDALQHCKARQATIPKDKRDKQQKDKRLVLTMEDLSKALREYGVNLKHQEYFADSPSTGMDPATREE*