Glyma18g05820 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g05820

Feature Type:	gene_model
Chromosome:	Gm18
Start:	4454562
stop:	4455780
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g05820

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G78370	AT	Annotation by Michelle Graham. TAIR10: glutathione S-transferase TAU 20 \| chr1:29484428-29485204 REVERSE LENGTH=217	SoyBase	E_val: 6.00E-63	ISS
GO:0000023	GO-bp	Annotation by Michelle Graham. GO Biological Process: maltose metabolic process	SoyBase	N/A	ISS
GO:0006569	GO-bp	Annotation by Michelle Graham. GO Biological Process: tryptophan catabolic process	SoyBase	N/A	ISS
GO:0009407	GO-bp	Annotation by Michelle Graham. GO Biological Process: toxin catabolic process	SoyBase	N/A	ISS
GO:0009684	GO-bp	Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process	SoyBase	N/A	ISS
GO:0019252	GO-bp	Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process	SoyBase	N/A	ISS
GO:0043085	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity	SoyBase	N/A	ISS
GO:2000030	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of response to red or far red light	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0004364	GO-mf	Annotation by Michelle Graham. GO Molecular Function: glutathione transferase activity	SoyBase	N/A	ISS
GO:0019899	GO-mf	Annotation by Michelle Graham. GO Molecular Function: enzyme binding	SoyBase	N/A	ISS
KOG0406	KOG	Glutathione S-transferase	JGI		ISS
PTHR11260	Panther	GLUTATHIONE S-TRANSFERASE, GST, SUPERFAMILY, GST DOMAIN CONTAINING	JGI		ISS
PTHR11260:SF54	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00043	PFAM	Glutathione S-transferase, C-terminal domain	JGI		ISS
PF02798	PFAM	Glutathione S-transferase, N-terminal domain	JGI		ISS
UniRef100_D2X9R0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Tau class glutathione transferase GSTU15 n=1 Tax=Populus trichocarpa RepID=D2X9R0_POPTR	SoyBase	E_val: 8.00E-73	ISS
UniRef100_I1MZP5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MZP5_SOYBN	SoyBase	E_val: 6.00E-116	ISS

Expression Patterns of Glyma18g05820

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g05820

Paralog	Evidence	Comments
Glyma11g31330	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g05820 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g05820

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g05820

Limit To All Plant Sequences

>Glyma18g05820.2   sequence type=CDS   gene model=Glyma18g05820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGAAGCCAATGTAGTGCCGTTGGATTTCTGGCCAAGCTCTTATGGAATGAGAGTGAAAATCGCTTTGGCAGAGAAGGGTATCTCATATGAGTGCAAACAAGAAGACTTGGAAGCTAAAAGTTCTCTGATTTTAGAGATGAACCCGGTTCACAAAATGATACCAGTTTTGATTCATAATGGAAAATCCATTTGTGAATCACTTAACATTGTTCAGTACATTGATGAGGCATGGAACCTCAAACCTTCTCTACTTCCATCTGACCTTTACAAACGATCCCAAGCCAGATTGGATATTTGTGAACGGTCAAATAATGTTCCTAATAACTACGACATGATAAGTTCAACAATAATAACCATGGAAGATGAACTTGGAGACAAGCCATATTTTGGTGGTGAGGACTTTGGGTATGTGGATGTGGCTCTTGTTCCCTTCACTAGCTGCTTTTACACGGTTGAGACCTGCGGGAAACTAAGCATAGAGGAAGAGTGTCCCAAACTTCTGGCTTGGCCAAGAGGTGCATGGAAAAAGAGTGTGGCCAAGTCACTCCCTCACCCACACCAGATCTATGCCTTTGCCATGCAGTATAAACAGAGACATGGACTAGAGTAG

Predicted protein sequences of Glyma18g05820

Limit To All Plant Sequences

>Glyma18g05820.2   sequence type=predicted peptide   gene model=Glyma18g05820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEANVVPLDFWPSSYGMRVKIALAEKGISYECKQEDLEAKSSLILEMNPVHKMIPVLIHNGKSICESLNIVQYIDEAWNLKPSLLPSDLYKRSQARLDICERSNNVPNNYDMISSTIITMEDELGDKPYFGGEDFGYVDVALVPFTSCFYTVETCGKLSIEEECPKLLAWPRGAWKKSVAKSLPHPHQIYAFAMQYKQRHGLE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain