SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g05640): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g05640): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g05640

Feature Type:gene_model
Chromosome:Gm18
Start:4239285
stop:4241479
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G58260AT Annotation by Michelle Graham. TAIR10: oxidoreductases, acting on NADH or NADPH, quinone or similar compound as acceptor | chr5:23561075-23561929 REVERSE LENGTH=209 SoyBaseE_val: 2.00E-100ISS
GO:0000023GO-bp Annotation by Michelle Graham. GO Biological Process: maltose metabolic process SoyBaseN/AISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0009817GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0010258GO-bp Annotation by Michelle Graham. GO Biological Process: NADH dehydrogenase complex (plastoquinone) assembly SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0016556GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA modification SoyBaseN/AISS
GO:0019252GO-bp Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process SoyBaseN/AISS
GO:0043085GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0010598GO-cc Annotation by Michelle Graham. GO Cellular Compartment: NAD(P)H dehydrogenase complex (plastoquinone) SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016655GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor SoyBaseN/AISS
PF11909PFAM NADH-quinone oxidoreductase cyanobacterial subunit N JGI ISS
UniRef100_G7IV78UniRef Annotation by Michelle Graham. Most informative UniRef hit: NAD(P)H-quinone oxidoreductase subunit N n=1 Tax=Medicago truncatula RepID=G7IV78_MEDTR SoyBaseE_val: 5.00E-130ISS
UniRef100_I1MZM9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MZM9_SOYBN SoyBaseE_val: 5.00E-170ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g05640 not represented in the dataset

Glyma18g05640 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma11g31620 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g049600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g05640.1   sequence type=CDS   gene model=Glyma18g05640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCATCCACTGCTAGCTTGGGTTATGGGGCTCCAACCTGCTTCAACAACGTTCATCACACAAAGAAGCAGCAAGCAATGAGGAACAGTTTCTTGAGCAATAAGCACAACAGTGTGAGAGTGATGAAGGGTTGGAGAGGAAGACATGGTAACACTAACAACACATCCAAAAGGGTAGGAATTGTGCAGTGTAGAGGGTTAGGGGACTTCATAGGTGGAGACTTGATAAAGTTTGATCTTGGACGTTGGCTTTCAGATGTTGAAGAGCACAAAGCACTTGCAATATACCCTCCTCATGAAGGAGGCTATGAGGGCCGCTACTTGTCGCGTCTCAAACGCCAAGGGTACTATTTCCTCGACCTTACGGCTCGTGGCCTTGGTGATCCTGAAACCACCCTCACCAAGATTCACCCTGTTTGCCCTCCTCATGTTGGCAAGCAGCCAATAGCAAGGTGGTATTTCCCACCAGAAGTTGATTACAGATTAGAAGCGTTGCCACCAAATGCCAAAGGATTGGTAGTGTGGATAATTGAAGCCAAGGTTCTCTCTAAGGCAGAACTGCAGTTCCTAGCTTTGCTGCCAACACTTAGGCCTAATGTGAGGGTCATTGCTGAATGTGGAAACTGGAGAAAGTTTATGTGGAAGCCACTTAAAGAAATTGCGGGACTAACAACCAGTGAGGAAGCTTGA

>Glyma18g05640.1   sequence type=predicted peptide   gene model=Glyma18g05640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSTASLGYGAPTCFNNVHHTKKQQAMRNSFLSNKHNSVRVMKGWRGRHGNTNNTSKRVGIVQCRGLGDFIGGDLIKFDLGRWLSDVEEHKALAIYPPHEGGYEGRYLSRLKRQGYYFLDLTARGLGDPETTLTKIHPVCPPHVGKQPIARWYFPPEVDYRLEALPPNAKGLVVWIIEAKVLSKAELQFLALLPTLRPNVRVIAECGNWRKFMWKPLKEIAGLTTSEEA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo