Glyma18g04725 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g04725): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g04725): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g04725

Feature Type:	gene_model
Chromosome:	Gm18
Start:	3504859
stop:	3507025
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g04725

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G16940	AT	Annotation by Michelle Graham. TAIR10: carbon-sulfur lyases \| chr5:5571797-5572204 REVERSE LENGTH=135	SoyBase	E_val: 2.00E-66	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0016846	GO-mf	Annotation by Michelle Graham. GO Molecular Function: carbon-sulfur lyase activity	SoyBase	N/A	ISS
KOG4192	KOG	Uncharacterized conserved protein	JGI		ISS
PF04828	PFAM	Glutathione-dependent formaldehyde-activating enzyme	JGI		ISS
UniRef100_G7J8R5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Centromere protein V n=1 Tax=Medicago truncatula RepID=G7J8R5_MEDTR	SoyBase	E_val: 6.00E-78	ISS
UniRef100_UPI000233F432	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233F432 related cluster n=1 Tax=unknown RepID=UPI000233F432	SoyBase	E_val: 3.00E-97	ISS

Expression Patterns of Glyma18g04725

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g04725 not represented in the dataset	Glyma18g04725 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g04725 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g041600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g04725

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g04725

Limit To All Plant Sequences

>Glyma18g04725.1   sequence type=CDS   gene model=Glyma18g04725   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGCCGAGAAAGTGGTGCATACTGGAGGCTGCCATTGTAAGAGTGTAAGGTGGAAAGTGGTTGCTTCTTCCAGTGTTATTGCATGGGATTGCAACTGCTCAAACTGCTACATGAGAGCCAATACTCACTTCGTTGTACCTGCTGTCAATTTTGAGCTTTTGGGAGATTCTGGGAAGTTTCTTACAACTTACACTTTTGGCACTCACACTGCAAAGCACACATTCTGTAAAATCTGTGGCATAACCTCATTCTATCATCCACGCTCAAACCCAGATGGGATTGCTGTTACATTTAAGTGTGTTGACCCTGGAACGTTGACTCACGTTGAAATCAGGCATGCTGATGGGAAGAATTGGGAAAGGGCAGTTATTGAGACAGGCATCGCTTCATATTCAAAGGTGCAGAAGTAA

Predicted protein sequences of Glyma18g04725

Limit To All Plant Sequences

>Glyma18g04725.1   sequence type=predicted peptide   gene model=Glyma18g04725   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDAEKVVHTGGCHCKSVRWKVVASSSVIAWDCNCSNCYMRANTHFVVPAVNFELLGDSGKFLTTYTFGTHTAKHTFCKICGITSFYHPRSNPDGIAVTFKCVDPGTLTHVEIRHADGKNWERAVIETGIASYSKVQK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain